Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (08 May 2019)
Sequence version 2 (08 Nov 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho GTPase-activating protein 7

Gene

Dlc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a GTPase-activating protein for the small GTPases RHOA, RHOB, RHOC and CDC42, terminating their downstream signaling. This induces morphological changes and detachment through cytoskeletal reorganization, playing a critical role in biological processes such as cell migration and proliferation. Also functions in vivo as an activator of the phospholipase PLCD1. Active DLC1 increases cell migration velocity but reduces directionality (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-194840 Rho GTPase cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GTPase-activating protein 7
Alternative name(s):
Deleted in liver cancer 1 protein homolog
Short name:
DLC-1
Rho-type GTPase-activating protein 7
START domain-containing protein 12
Short name:
StARD12
StAR-related lipid transfer protein 12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dlc1
Synonyms:Arhgap7, Stard12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1354949 Dlc1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567081 – 1092Rho GTPase-activating protein 7Add BLAST1092

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei86PhosphoserineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei129PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9R0Z9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9R0Z9

PRoteomics IDEntifications database

More...
PRIDEi
Q9R0Z9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9R0Z9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9R0Z9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with the highest levels in heart, liver and lung.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EF1A1, facilitates EF1A1 distribution to the membrane periphery and ruffles upon growth factor stimulation and suppresses cell migration.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206100, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9R0Z9, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000033923

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9R0Z9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini11 – 78SAMAdd BLAST68
Domaini642 – 848Rho-GAPPROSITE-ProRule annotationAdd BLAST207
Domaini878 – 1085STARTPROSITE-ProRule annotationAdd BLAST208

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni275 – 448Focal adhesion-targeting (FAT)By similarityAdd BLAST174
Regioni615 – 637Polybasic cluster (PBR)By similarityAdd BLAST23

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi306 – 312Poly-Ser7
Compositional biasi432 – 438Poly-Ser7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SAM domain mediates interaction with EF1A1, and functions as an autoinhibitory regulator of RhoGAP Activity.By similarity
The polybasic cluster is required for activation and mediates binding to phosphatidylinositol-4,5-bisphosphate (PI(4,5)P2) containing membranes.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2200 Eukaryota
ENOG410XQ10 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000039960

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9R0Z9

KEGG Orthology (KO)

More...
KOi
K20632

Database of Orthologous Groups

More...
OrthoDBi
218349at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9R0Z9

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
3.30.530.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028854 DLC1
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR023393 START-like_dom_sf
IPR002913 START_lipid-bd_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12659:SF2 PTHR12659:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00620 RhoGAP, 1 hit
PF07647 SAM_2, 1 hit
PF01852 START, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00324 RhoGAP, 1 hit
SM00234 START, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769 SSF47769, 1 hit
SSF48350 SSF48350, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50238 RHOGAP, 1 hit
PS50848 START, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9R0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCRDEPDTMI LTQIEAKEAC DWLRVTGFPQ YAQLYEDLLF PVDIALVKRE
60 70 80 90 100
HDFLDRDAIE ALCRRLNTLN KCAVMKLEIS PHRKRSEDSD EDEPCAISGK
110 120 130 140 150
WTFQRDSKRW SRLEEFDVFF PKQDPIPGSP DNSRLQSATS HESMLTDLSE
160 170 180 190 200
HQEVASVRSL SSTSSSVPTH AAHSGDATTP RTNSVISVCS SGHFVGNDDS
210 220 230 240 250
FSSLPSPKEL SSFSFSMKGH HEKNTKSKTR SLLKRMESLK LKGSHHSKHK
260 270 280 290 300
APSKLGLIIS APILQEGMDE AKLKQLNCVE ISALNGNHIN VPMVRKRSVS
310 320 330 340 350
NSTQTSSSSS QSETSSAVST PSPVTRTRSL STCNKRVGMY LEGFDPFSQS
360 370 380 390 400
TLNNVTEQNY KNRESYPEDT VFYIPEDHKP GTFPKALSHG SFCPSGNSSV
410 420 430 440 450
NWRTGSFHGP GHLSLRRENS HDSPKELKRR NSSSSLSSRL SIYDNVPGSI
460 470 480 490 500
LYSSSGELAD LENEDIFPEL DDILYHVKGM QRIVNQWSEK FSDEGDSDSA
510 520 530 540 550
LDSVSPCPSS PKQIHLDVDH DRRTPSDLDS TGNSLNEPEE PTDIPERRDS
560 570 580 590 600
GVGASLTRCN RHRLRWHSFQ SSHRPSLNSV SLQINCQSVA QMNLLQKYSL
610 620 630 640 650
LKLTALLEKY TPSNKHGFSW AVPKFMKRIK VPDYKDRSVF GVPLTVNVQR
660 670 680 690 700
SGQPLPQSIQ QAMRYLRNHC LDQVGLFRKS GVKSRIQALR QMNESAEDNV
710 720 730 740 750
NYEGQSAYDV ADMLKQYFRD LPEPLMTNKL SETFLQIYQY VPKDQRLQAI
760 770 780 790 800
KAAIMLLPDE NREVLQTLLY FLSDVTAAVK ENQMTPTNLA VCLAPSLFHL
810 820 830 840 850
NTLKRENSSP RVMQRKQSLG KPDQKDLNEN LAATQGLAHM IAECKKLFQV
860 870 880 890 900
PEEMSRCRNS YTEQELKPLT LEALGHLNSD QPADYRHFLQ DCVDGLFKEV
910 920 930 940 950
KEKFKGWVSY PTSEQADLSY KKVSEGPPLR LWRSTIEVPA APEEILKRLL
960 970 980 990 1000
KEQHLWDVDL LDSKVIEILD SQTEIYQYVQ NSMAPHPARD YVVLRTWRTN
1010 1020 1030 1040 1050
LPRGACALLL TSVDHDRAPV AGVRVNVLLS RYLIEPCGSG KSKLTYMCRA
1060 1070 1080 1090
DLRGHMPEWY SKSFGHLCAA EVVKIRDSFS NQNTESKDTR SR
Length:1,092
Mass (Da):123,367
Last modified:November 8, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9B5DC3103986A751
GO
Isoform 2 (identifier: Q9R0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MCRDEPDTMILTQ → MGDPEGHVMARPLRGPLRRSFSDHIRDSTARALDAIWKNTRERRLAE

Note: No experimental confirmation available.
Show »
Length:1,126
Mass (Da):127,257
Checksum:i5FEA7BA290AE36CE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PXD2E9PXD2_MOUSE
Rho GTPase-activating protein 7
Dlc1
1,543Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QKB1E9QKB1_MOUSE
Rho GTPase-activating protein 7
Dlc1
1,092Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J171A0A0R4J171_MOUSE
Rho GTPase-activating protein 7
Dlc1
1,126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QPV2J3QPV2_MOUSE
Rho GTPase-activating protein 7
Dlc1
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL87620 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti42V → I in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti42V → I in BAE27982 (PubMed:16141072).Curated1
Sequence conflicti120F → S in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti120F → S in BAE27982 (PubMed:16141072).Curated1
Sequence conflicti192G → R in AAD51760 (PubMed:10702663).Curated1
Sequence conflicti421 – 422HD → SH in AAD51760 (PubMed:10702663).Curated2
Sequence conflicti715 – 717KQY → NRN in AAD51760 (PubMed:10702663).Curated3
Sequence conflicti730 – 735LSETFL → FSEPSM in AAD51760 (PubMed:10702663).Curated6
Sequence conflicti917D → E in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti917D → E in BAE27982 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0261441 – 13MCRDE…MILTQ → MGDPEGHVMARPLRGPLRRS FSDHIRDSTARALDAIWKNT RERRLAE in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF178078 mRNA Translation: AAD51760.1
AF411442
, AF411435, AF411436, AF411437, AF411438, AF411439, AF411440, AF411441 Genomic DNA Translation: AAL87620.1 Different initiation.
AK147539 mRNA Translation: BAE27982.1
AK162413 mRNA Translation: BAE36903.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40322.1 [Q9R0Z9-1]
CCDS57616.1 [Q9R0Z9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001181870.1, NM_001194941.1
NP_056617.2, NM_015802.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50768

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50768

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178078 mRNA Translation: AAD51760.1
AF411442
, AF411435, AF411436, AF411437, AF411438, AF411439, AF411440, AF411441 Genomic DNA Translation: AAL87620.1 Different initiation.
AK147539 mRNA Translation: BAE27982.1
AK162413 mRNA Translation: BAE36903.1
CCDSiCCDS40322.1 [Q9R0Z9-1]
CCDS57616.1 [Q9R0Z9-2]
RefSeqiNP_001181870.1, NM_001194941.1
NP_056617.2, NM_015802.3

3D structure databases

SMRiQ9R0Z9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206100, 1 interactor
IntActiQ9R0Z9, 1 interactor
STRINGi10090.ENSMUSP00000033923

PTM databases

iPTMnetiQ9R0Z9
PhosphoSitePlusiQ9R0Z9

Proteomic databases

jPOSTiQ9R0Z9
PaxDbiQ9R0Z9
PRIDEiQ9R0Z9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi50768
KEGGimmu:50768

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10395
MGIiMGI:1354949 Dlc1

Phylogenomic databases

eggNOGiKOG2200 Eukaryota
ENOG410XQ10 LUCA
HOGENOMiHOG000039960
InParanoidiQ9R0Z9
KOiK20632
OrthoDBi218349at2759
PhylomeDBiQ9R0Z9

Enzyme and pathway databases

ReactomeiR-MMU-194840 Rho GTPase cycle

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dlc1 mouse

Protein Ontology

More...
PROi
PR:Q9R0Z9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di1.10.555.10, 1 hit
3.30.530.20, 1 hit
InterProiView protein in InterPro
IPR028854 DLC1
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR023393 START-like_dom_sf
IPR002913 START_lipid-bd_dom
PANTHERiPTHR12659:SF2 PTHR12659:SF2, 1 hit
PfamiView protein in Pfam
PF00620 RhoGAP, 1 hit
PF07647 SAM_2, 1 hit
PF01852 START, 1 hit
SMARTiView protein in SMART
SM00324 RhoGAP, 1 hit
SM00234 START, 1 hit
SUPFAMiSSF47769 SSF47769, 1 hit
SSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50238 RHOGAP, 1 hit
PS50848 START, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHG07_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9R0Z9
Secondary accession number(s): Q3TRX3, Q3UH75, Q8R541
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 8, 2002
Last modified: May 8, 2019
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again