Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 5 member A

Gene

Clec5a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a positive regulator of osteoclastogenesis (PubMed:19251634). Cell surface receptor that signals via TYROBP (PubMed:10449773). Regulates inflammatory responses (PubMed:20212065).3 Publications

Miscellaneous

Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation when its activation leads to enhanced recruitment of inflammatory macrophages and neutrophils to the joints.1 Publication

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • virus receptor activity Source: UniProtKB

GO - Biological processi

  • innate immune response Source: UniProtKB
  • myeloid cell differentiation Source: MGI
  • negative regulation of apoptotic process Source: UniProtKB
  • negative regulation of myeloid cell apoptotic process Source: MGI
  • osteoblast development Source: UniProtKB
  • positive regulation of cytokine secretion Source: UniProtKB

Keywordsi

Biological processImmunity, Innate immunity
LigandLectin

Enzyme and pathway databases

ReactomeiR-MMU-2172127 DAP12 interactions
R-MMU-6798695 Neutrophil degranulation

Protein family/group databases

MEROPSiI63.002

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 5 member A
Alternative name(s):
C-type lectin superfamily member 5
Myeloid DAP12-associating lectin 1
Short name:
MDL-1
Gene namesi
Name:Clec5a
Synonyms:Clecsf5, Mdl1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1345151 Clec5a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4CytoplasmicSequence analysis4
Transmembranei5 – 25Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini26 – 190ExtracellularSequence analysisAdd BLAST165

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Involved in the pathogenetic mechanisms of Japanese encephalitis virus (JEV) infection of the brain. JEV infection of young mice results in increased expression of CLEC5A in spleen and brain with consequent activation of proinflammatory cytokine secretion.1 Publication

Disruption phenotypei

Mutants are viable, are born in the expected Mendelian ratios and have similar numbers of myeloid and lymphoid cell subsets as wild-type animals (PubMed:20212065). Inhibition of autoimmune joint inflammation and preservation of bone density (PubMed:20212065).1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000466331 – 190C-type lectin domain family 5 member AAdd BLAST190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi51N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi101 ↔ 185PROSITE-ProRule annotation
Glycosylationi146N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi163 ↔ 177PROSITE-ProRule annotation

Post-translational modificationi

N-glycosylated (PubMed:19074552, PubMed:19251634). Contains sialic acid residues (PubMed:19074552).2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9R007
PaxDbiQ9R007
PRIDEiQ9R007

Expressioni

Tissue specificityi

Strong expression in bone marrow cells and thioglycollate-induced neutrophils (at protein level) (PubMed:19074552). Expressed on granulocytes and monocytes from bone marrow and peripheral blood (PubMed:20212065). Expressed in macrophage cell line J-774, but not in T-cell lines, B-cell lines, or mast cell lines (PubMed:10449773).3 Publications

Inductioni

By TNF in bone-marrow derived macrophage colony-stimulating factor-dependent macrophages (PubMed:20212065). Up-regulated during the differentiation of myeloid cell line 32Dcl3 into neutrophils (PubMed:19074552).2 Publications

Gene expression databases

BgeeiENSMUSG00000029915 Expressed in 47 organ(s), highest expression level in bone marrow
CleanExiMM_CLEC5A
ExpressionAtlasiQ9R007 baseline and differential
GenevisibleiQ9R007 MM

Interactioni

Subunit structurei

Monomer (By similarity). Homodimer (By similarity). The majority of CLEC5A is expressed as a monomeric form on macrophages (By similarity). Interacts with TYROBP/DAP12 (PubMed:10449773). The interaction with TYROBP is required for CLEC5 cell surface expression (PubMed:10449773). Interacts with HCST/DAP10 (PubMed:19074552, PubMed:19251634). Forms a CLEC5A/TYROBP/HCST trimolecular complex depending almost solely on TYROBP (PubMed:19251634).By similarity3 Publications

Binary interactionsi

Protein-protein interaction databases

DIPiDIP-48775N
IntActiQ9R007, 2 interactors
STRINGi10090.ENSMUSP00000121848

Structurei

3D structure databases

ProteinModelPortaliQ9R007
SMRiQ9R007
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini80 – 186C-type lectinPROSITE-ProRule annotationAdd BLAST107

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00910000144330
HOGENOMiHOG000252978
HOVERGENiHBG081250
InParanoidiQ9R007
KOiK10073
OMAiELSWNKS
OrthoDBiEOG091G0NHI
PhylomeDBiQ9R007
TreeFamiTF337735

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: Q9R007-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNWHMIISGL IVVVIKVVGM TFFLLYFPQV FGKSNDGFVP TESYGTTSVQ
60 70 80 90 100
NVSQIFGRND ESTMPTRSYG TVCPRNWDFH QGKCFFFSFS ESPWKDSMDY
110 120 130 140 150
CATQGSTLAI VNTPEKLKYL QDIAGIENYF IGLVRQPGEK KWRWINNSVF
160 170 180 190
NGNVTNQDQN FDCVTIGLTK TYDAASCEVS YRWICEMNAK
Length:190
Mass (Da):21,696
Last modified:June 28, 2011 - v2
Checksum:iAB6AACB3A8D36637
GO
Isoform 1 (identifier: Q9R007-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-57: PQVFGKSNDGFVPTESYGTTSVQNVSQIFG → SQIFG

Show »
Length:165
Mass (Da):19,055
Checksum:i626D64392A513282
GO
Isoform 2 (identifier: Q9R007-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-118: Missing.

Show »
Length:189
Mass (Da):21,567
Checksum:i28C26A90421D745D
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J269A0A0R4J269_MOUSE
C-type lectin domain family 5 membe...
Clec5a mCG_15099
164Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04157728 – 57PQVFG…SQIFG → SQIFG in isoform 1. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_012840118Missing in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139769 mRNA Translation: AAF02492.1
AK036697 mRNA Translation: BAC29537.1
AK046600 mRNA Translation: BAC32802.1
AK137482 mRNA Translation: BAE23374.1
CH466533 Genomic DNA Translation: EDL13570.1
BC104364 mRNA Translation: AAI04365.1
BC104365 mRNA Translation: AAI04366.1
CCDSiCCDS20036.1 [Q9R007-3]
CCDS20037.1 [Q9R007-1]
RefSeqiNP_001033693.1, NM_001038604.1 [Q9R007-3]
NP_067339.1, NM_021364.2 [Q9R007-1]
UniGeneiMm.103765

Genome annotation databases

EnsembliENSMUST00000101491; ENSMUSP00000099030; ENSMUSG00000029915 [Q9R007-1]
ENSMUST00000129948; ENSMUSP00000121848; ENSMUSG00000029915 [Q9R007-3]
GeneIDi23845
KEGGimmu:23845
UCSCiuc009bna.1 mouse [Q9R007-3]
uc009bnb.1 mouse [Q9R007-1]
uc009bnc.1 mouse [Q9R007-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

MDL-1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139769 mRNA Translation: AAF02492.1
AK036697 mRNA Translation: BAC29537.1
AK046600 mRNA Translation: BAC32802.1
AK137482 mRNA Translation: BAE23374.1
CH466533 Genomic DNA Translation: EDL13570.1
BC104364 mRNA Translation: AAI04365.1
BC104365 mRNA Translation: AAI04366.1
CCDSiCCDS20036.1 [Q9R007-3]
CCDS20037.1 [Q9R007-1]
RefSeqiNP_001033693.1, NM_001038604.1 [Q9R007-3]
NP_067339.1, NM_021364.2 [Q9R007-1]
UniGeneiMm.103765

3D structure databases

ProteinModelPortaliQ9R007
SMRiQ9R007
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-48775N
IntActiQ9R007, 2 interactors
STRINGi10090.ENSMUSP00000121848

Protein family/group databases

MEROPSiI63.002

Proteomic databases

MaxQBiQ9R007
PaxDbiQ9R007
PRIDEiQ9R007

Protocols and materials databases

DNASUi23845
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000101491; ENSMUSP00000099030; ENSMUSG00000029915 [Q9R007-1]
ENSMUST00000129948; ENSMUSP00000121848; ENSMUSG00000029915 [Q9R007-3]
GeneIDi23845
KEGGimmu:23845
UCSCiuc009bna.1 mouse [Q9R007-3]
uc009bnb.1 mouse [Q9R007-1]
uc009bnc.1 mouse [Q9R007-2]

Organism-specific databases

CTDi23601
MGIiMGI:1345151 Clec5a

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00910000144330
HOGENOMiHOG000252978
HOVERGENiHBG081250
InParanoidiQ9R007
KOiK10073
OMAiELSWNKS
OrthoDBiEOG091G0NHI
PhylomeDBiQ9R007
TreeFamiTF337735

Enzyme and pathway databases

ReactomeiR-MMU-2172127 DAP12 interactions
R-MMU-6798695 Neutrophil degranulation

Miscellaneous databases

PROiPR:Q9R007
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029915 Expressed in 47 organ(s), highest expression level in bone marrow
CleanExiMM_CLEC5A
ExpressionAtlasiQ9R007 baseline and differential
GenevisibleiQ9R007 MM

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCLC5A_MOUSE
AccessioniPrimary (citable) accession number: Q9R007
Secondary accession number(s): Q3SXC9, Q3UV97, Q8BL24
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: June 28, 2011
Last modified: November 7, 2018
This is version 133 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again