Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (16 Oct 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Solute carrier organic anion transporter family member 1B2

Gene

Slco1b2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the Na+-independent uptake of organic anions such as taurochlate, bromosulfophthalein and steroid conjugates such as estrone-3-sulfate, 17-beta-glucuronosyl estradiol, dehydroepiandrosterone sulfate and prostaglandin E2.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-159418 Recycling of bile acids and salts
R-RNO-879518 Transport of organic anions

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.60.1.8 the organo anion transporter (oat) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 1B2
Alternative name(s):
Liver-specific organic anion transporter 1
Short name:
rLST-1
Sodium-independent organic anion-transporting polypeptide 4
Short name:
OATP-4
Solute carrier family 21 member 10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slco1b2
Synonyms:Oatp1b2, Slc21a10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
69300 Slco1b2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 28CytoplasmicSequence analysisAdd BLAST28
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei29 – 48HelicalSequence analysisAdd BLAST20
Topological domaini49 – 67ExtracellularSequence analysisAdd BLAST19
Transmembranei68 – 88HelicalSequence analysisAdd BLAST21
Topological domaini89 – 94CytoplasmicSequence analysis6
Transmembranei95 – 119HelicalSequence analysisAdd BLAST25
Topological domaini120 – 165ExtracellularSequence analysisAdd BLAST46
Transmembranei166 – 194HelicalSequence analysisAdd BLAST29
Topological domaini195 – 213CytoplasmicSequence analysisAdd BLAST19
Transmembranei214 – 234HelicalSequence analysisAdd BLAST21
Topological domaini235 – 252ExtracellularSequence analysisAdd BLAST18
Transmembranei253 – 277HelicalSequence analysisAdd BLAST25
Topological domaini278 – 328CytoplasmicSequence analysisAdd BLAST51
Transmembranei329 – 350HelicalSequence analysisAdd BLAST22
Topological domaini351 – 370ExtracellularSequence analysisAdd BLAST20
Transmembranei371 – 394HelicalSequence analysisAdd BLAST24
Topological domaini395 – 398CytoplasmicSequence analysis4
Transmembranei399 – 422HelicalSequence analysisAdd BLAST24
Topological domaini423 – 531ExtracellularSequence analysisAdd BLAST109
Transmembranei532 – 554HelicalSequence analysisAdd BLAST23
Topological domaini555 – 563CytoplasmicSequence analysis9
Transmembranei564 – 589HelicalSequence analysisAdd BLAST26
Topological domaini590 – 623ExtracellularSequence analysisAdd BLAST34
Transmembranei624 – 641HelicalSequence analysisAdd BLAST18
Topological domaini642 – 687CytoplasmicSequence analysisAdd BLAST46

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1781861

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001910521 – 687Solute carrier organic anion transporter family member 1B2Add BLAST687

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi134N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei290PhosphoserineCombined sources1
Modified residuei292PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi456 ↔ 482PROSITE-ProRule annotation
Disulfide bondi460 ↔ 471PROSITE-ProRule annotation
Disulfide bondi462 ↔ 486PROSITE-ProRule annotation
Glycosylationi496N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi511N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei660PhosphothreonineCombined sources1
Modified residuei667PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QZX8

PRoteomics IDEntifications database

More...
PRIDEi
Q9QZX8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QZX8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QZX8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Liver specific. Expression is highest in central perivenous hepatocytes and lowest in the periportal region. Isoform 1 predominates. Not detected in heart, brain, kidney, skeletal muscle, lung, testis or spleen.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000030538 Expressed in 4 organ(s), highest expression level in liver

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QZX8 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9QZX8, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000013409

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini450 – 507Kazal-likePROSITE-ProRule annotationAdd BLAST58

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3626 Eukaryota
ENOG410XRSF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00970000193398

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QZX8

KEGG Orthology (KO)

More...
KOi
K05043

Identification of Orthologs from Complete Genome Data

More...
OMAi
TNTTLMC

Database of Orthologous Groups

More...
OrthoDBi
1029129at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QZX8

TreeFam database of animal gene trees

More...
TreeFami
TF317540

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP

The PANTHER Classification System

More...
PANTHERi
PTHR11388 PTHR11388, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00805 oat, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9QZX8-2) [UniParc]FASTAAdd to basket
Also known as: rLST-1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDHTQQSRKA AEAQPSRSKQ TRFCDGFKLF LAALSFSYIC KALGGVVMKS
60 70 80 90 100
SITQIERRFD IPSSISGLID GGFEIGNLLV IVFVSYFGSK LHRPKLIGIG
110 120 130 140 150
CFIMGIGSIL TALPHFFMGY YKYAKENDIG SLGNSTLTCF INQMTSPTGP
160 170 180 190 200
SPEIVEKGCE KGLKSHMWIY VLMGNMLRGI GETPIVPLGI SYLDDFAKEG
210 220 230 240 250
HTSMHLGTLH TIAMIGPILG FIMSSVFAKI YVDVGYVDLN SVRITPNDAR
260 270 280 290 300
WVGAWWLSFI VNGLLCITSS IPFFFLPKIP KRSQEERKNS VSLHAPKTDE
310 320 330 340 350
EKKHMTNLTK QEEQDPSNMT GFLRSLRSIL TNEIYVIFLI LTLLQVSGFI
360 370 380 390 400
GSFTYLFKFI EQQFGRTASQ ANFLLGIITI PTMATAMFLG GYIVKKFKLT
410 420 430 440 450
SVGIAKFVFF TSSVAYAFQF LYFPLLCENK PFAGLTLTYD GMNPVDSHID
460 470 480 490 500
VPLSYCNSDC SCDKNQWEPI CGENGVTYIS PCLAGCKSFR GDKKPNNTEF
510 520 530 540 550
YDCSCISNSG NNSAHLGECP RYKCKTNYYF YIILQVTVSF FTAMGSPSLI
560 570 580 590 600
LILMKSVQPE LKSLAMGFHS LIIRALGGIL APIYYGAFID RTCIKWSVTS
610 620 630 640 650
CGKRGACRLY NSRLFGFSYL GLNLALKTPP LFLYVVLIYF TKRKYKRNDN
660 670 680
KTLENGRQFT DEGNPDSVNK NGYYCVPYDE QSNETPL
Length:687
Mass (Da):76,767
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE6A17786FD136CC6
GO
Isoform 2 (identifier: Q9QZX8-1) [UniParc]FASTAAdd to basket
Also known as: rLST-1b

The sequence of this isoform differs from the canonical sequence as follows:
     407-441: Missing.

Show »
Length:652
Mass (Da):72,767
Checksum:i8100FD4248893F70
GO
Isoform 3 (identifier: Q9QZX8-3) [UniParc]FASTAAdd to basket
Also known as: rLST-1c

The sequence of this isoform differs from the canonical sequence as follows:
     207-240: GTLHTIAMIGPILGFIMSSVFAKIYVDVGYVDLN → D

Show »
Length:654
Mass (Da):73,244
Checksum:iE3A31785AE9C76E0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006151207 – 240GTLHT…YVDLN → D in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_006150407 – 441Missing in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF147740 mRNA Translation: AAF02526.1
AF208545 mRNA Translation: AAF87098.1
AF217450 mRNA Translation: AAF87099.1
AF272571
, AF272558, AF272559, AF272560, AF272561, AF272562, AF272563, AF272564, AF272565, AF272566, AF272567, AF272568, AF272569, AF272570 Genomic DNA Translation: AAF90136.1
AJ271682 mRNA Translation: CAB92299.1

NCBI Reference Sequences

More...
RefSeqi
NP_001257515.1, NM_001270586.1 [Q9QZX8-1]
NP_001257516.1, NM_001270587.1 [Q9QZX8-3]
NP_113838.1, NM_031650.3 [Q9QZX8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000013409; ENSRNOP00000013409; ENSRNOG00000030538 [Q9QZX8-2]
ENSRNOT00000013514; ENSRNOP00000013514; ENSRNOG00000030538 [Q9QZX8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
58978

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:58978

UCSC genome browser

More...
UCSCi
RGD:69300 rat [Q9QZX8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF147740 mRNA Translation: AAF02526.1
AF208545 mRNA Translation: AAF87098.1
AF217450 mRNA Translation: AAF87099.1
AF272571
, AF272558, AF272559, AF272560, AF272561, AF272562, AF272563, AF272564, AF272565, AF272566, AF272567, AF272568, AF272569, AF272570 Genomic DNA Translation: AAF90136.1
AJ271682 mRNA Translation: CAB92299.1
RefSeqiNP_001257515.1, NM_001270586.1 [Q9QZX8-1]
NP_001257516.1, NM_001270587.1 [Q9QZX8-3]
NP_113838.1, NM_031650.3 [Q9QZX8-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ9QZX8, 1 interactor
STRINGi10116.ENSRNOP00000013409

Chemistry databases

ChEMBLiCHEMBL1781861

Protein family/group databases

TCDBi2.A.60.1.8 the organo anion transporter (oat) family

PTM databases

iPTMnetiQ9QZX8
PhosphoSitePlusiQ9QZX8

Proteomic databases

PaxDbiQ9QZX8
PRIDEiQ9QZX8

Genome annotation databases

EnsembliENSRNOT00000013409; ENSRNOP00000013409; ENSRNOG00000030538 [Q9QZX8-2]
ENSRNOT00000013514; ENSRNOP00000013514; ENSRNOG00000030538 [Q9QZX8-3]
GeneIDi58978
KEGGirno:58978
UCSCiRGD:69300 rat [Q9QZX8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
28253
RGDi69300 Slco1b2

Phylogenomic databases

eggNOGiKOG3626 Eukaryota
ENOG410XRSF LUCA
GeneTreeiENSGT00970000193398
InParanoidiQ9QZX8
KOiK05043
OMAiTNTTLMC
OrthoDBi1029129at2759
PhylomeDBiQ9QZX8
TreeFamiTF317540

Enzyme and pathway databases

ReactomeiR-RNO-159418 Recycling of bile acids and salts
R-RNO-879518 Transport of organic anions

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9QZX8

Gene expression databases

BgeeiENSRNOG00000030538 Expressed in 4 organ(s), highest expression level in liver
GenevisibleiQ9QZX8 RN

Family and domain databases

InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP
PANTHERiPTHR11388 PTHR11388, 1 hit
PfamiView protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit
SUPFAMiSSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00805 oat, 1 hit
PROSITEiView protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSO1B2_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QZX8
Secondary accession number(s): Q9JHF6, Q9JIM2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 11, 2011
Last modified: October 16, 2019
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again