Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family B member 2

Gene

Plekhb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in retrograde transport of recycling endosomes.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei20PhosphatidylserineBy similarity1

GO - Molecular functioni

GO - Biological processi

  • regulation of cell differentiation Source: GO_Central

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family B member 2
Short name:
PH domain-containing family B member 2
Alternative name(s):
Evectin-2
Gene namesi
Name:Plekhb2
Synonyms:Evt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:2385825 Plekhb2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538901 – 221Pleckstrin homology domain-containing family B member 2Add BLAST221

Proteomic databases

PaxDbiQ9QZC7
PRIDEiQ9QZC7

PTM databases

iPTMnetiQ9QZC7
PhosphoSitePlusiQ9QZC7

Expressioni

Tissue specificityi

Highly expressed in brain, retina, heart and kidney. Detected at lower levels in lung, muscle and nerve.1 Publication

Developmental stagei

Highly expressed at birth and up to day 3; expressed at lower levels in embryo and adult.

Gene expression databases

BgeeiENSMUSG00000026123 Expressed in 278 organ(s), highest expression level in retina
ExpressionAtlasiQ9QZC7 baseline and differential
GenevisibleiQ9QZC7 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297

Structurei

Secondary structure

1221
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9QZC7
SMRiQ9QZC7
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QZC7

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 109PHPROSITE-ProRule annotationAdd BLAST108

Domaini

The PH domain specifically binds phosphatidylserine, which is enriched in recycling endosome membranes, it doesn't recognize PIPs.By similarity

Phylogenomic databases

eggNOGiENOG410IFNJ Eukaryota
ENOG4111G6I LUCA
GeneTreeiENSGT00390000013989
HOGENOMiHOG000253945
HOVERGENiHBG060487
InParanoidiQ9QZC7
OMAiCINIRMG
OrthoDBiEOG091G14FB
PhylomeDBiQ9QZC7
TreeFamiTF331787

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR039680 PLEKHB1/2
IPR039815 PLEKHB2
PANTHERiPTHR14309 PTHR14309, 1 hit
PTHR14309:SF8 PTHR14309:SF8, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QZC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFVKSGWLL RQSTILKRWK KNWFDLWSDG HLIYYDDQTR QSIEDKVHMP
60 70 80 90 100
VDCINIRTGH ECRDIQPPDG KPRDCLLQIV CRDGKTISLC AESTDDCLAW
110 120 130 140 150
KFTLQDSRTN TAYVGSAILS EETAVAASPP PYAAYATPTP EVYGYGPYSG
160 170 180 190 200
AYPAGTQVVY AANGQAYAVP YQYPYAGVYG QQPANQVIIR ERYRDNDSDL
210 220
ALGMLAGAAT GMALGSLFWV F
Length:221
Mass (Da):24,574
Last modified:May 1, 2000 - v1
Checksum:i36B1E3CA014E1C66
GO
Isoform 2 (identifier: Q9QZC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-221: RDNDSDLALGMLAGAATGMALGSLFWVF → QDYGVRTL

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):22,624
Checksum:i714670A8A748B318
GO
Isoform 3 (identifier: Q9QZC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-221: VYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF → NARWLPLPVSAYSGARRRRPPFQLEVK

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):22,923
Checksum:iF0522EF9C64DC397
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z3L2D3Z3L2_MOUSE
Pleckstrin homology domain-containi...
Plekhb2
65Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81C → W in BAC30448 (PubMed:16141072).Curated1
Sequence conflicti136A → G in BAC38413 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009785178 – 221VYGQQ…LFWVF → NARWLPLPVSAYSGARRRRP PFQLEVK in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_009786194 – 221RDNDS…LFWVF → QDYGVRTL in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA Translation: AAF01332.1
AK039771 mRNA Translation: BAC30448.1
AK082118 mRNA Translation: BAC38413.1
AK149868 mRNA Translation: BAE29136.1
AK150074 mRNA Translation: BAE29285.1
AK166091 mRNA Translation: BAE38565.1
BC057994 mRNA Translation: AAH57994.1
CCDSiCCDS14874.1 [Q9QZC7-1]
CCDS78558.1 [Q9QZC7-3]
RefSeqiNP_663491.1, NM_145516.2 [Q9QZC7-1]
XP_006495961.1, XM_006495898.3 [Q9QZC7-1]
XP_017175721.1, XM_017320232.1
UniGeneiMm.292751

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123 [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123 [Q9QZC7-3]
GeneIDi226971
KEGGimmu:226971
UCSCiuc007apl.1 mouse [Q9QZC7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA Translation: AAF01332.1
AK039771 mRNA Translation: BAC30448.1
AK082118 mRNA Translation: BAC38413.1
AK149868 mRNA Translation: BAE29136.1
AK150074 mRNA Translation: BAE29285.1
AK166091 mRNA Translation: BAE38565.1
BC057994 mRNA Translation: AAH57994.1
CCDSiCCDS14874.1 [Q9QZC7-1]
CCDS78558.1 [Q9QZC7-3]
RefSeqiNP_663491.1, NM_145516.2 [Q9QZC7-1]
XP_006495961.1, XM_006495898.3 [Q9QZC7-1]
XP_017175721.1, XM_017320232.1
UniGeneiMm.292751

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DHINMR-A3-109[»]
ProteinModelPortaliQ9QZC7
SMRiQ9QZC7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297

PTM databases

iPTMnetiQ9QZC7
PhosphoSitePlusiQ9QZC7

Proteomic databases

PaxDbiQ9QZC7
PRIDEiQ9QZC7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123 [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123 [Q9QZC7-3]
GeneIDi226971
KEGGimmu:226971
UCSCiuc007apl.1 mouse [Q9QZC7-1]

Organism-specific databases

CTDi55041
MGIiMGI:2385825 Plekhb2

Phylogenomic databases

eggNOGiENOG410IFNJ Eukaryota
ENOG4111G6I LUCA
GeneTreeiENSGT00390000013989
HOGENOMiHOG000253945
HOVERGENiHBG060487
InParanoidiQ9QZC7
OMAiCINIRMG
OrthoDBiEOG091G14FB
PhylomeDBiQ9QZC7
TreeFamiTF331787

Miscellaneous databases

ChiTaRSiPlekhb2 mouse
EvolutionaryTraceiQ9QZC7
PROiPR:Q9QZC7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026123 Expressed in 278 organ(s), highest expression level in retina
ExpressionAtlasiQ9QZC7 baseline and differential
GenevisibleiQ9QZC7 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR039680 PLEKHB1/2
IPR039815 PLEKHB2
PANTHERiPTHR14309 PTHR14309, 1 hit
PTHR14309:SF8 PTHR14309:SF8, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPKHB2_MOUSE
AccessioniPrimary (citable) accession number: Q9QZC7
Secondary accession number(s): Q3UDH6, Q8C4I4, Q8CA27
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 2000
Last modified: November 7, 2018
This is version 118 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again