Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (22 Apr 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein quaking

Gene

Qki

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein that plays a central role in myelinization (PubMed:10864952, PubMed:11917126). Also required for visceral endoderm function and blood vessel development (PubMed:11892011, PubMed:16470614). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence (PubMed:16041388). Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation, as well as cellular processes including apoptosis, cell cycle, glial cell fate and development (PubMed:10535969, PubMed:12467586, PubMed:11297509, PubMed:11917126, PubMed:15568022). Required to protect and promote stability of mRNAs such as MBP and CDKN1B which promotes oligodendrocyte differentiation (PubMed:10535969, PubMed:15568022). Participates in mRNA transport by regulating the nuclear export of MBP mRNA (PubMed:12467586). May also play a role in smooth muscle development (PubMed:14706070).10 Publications
Isoform 1 is involved in regulation of mRNA splicing of MAG pre-mRNA by acting as a negative regulator of MAG exon 12 alternative splicing.1 Publication
Isoform 3 can induce apoptosis, while heterodimerization with other isoforms results in nuclear translocation of isoform 3 and suppression of apoptosis.1 Publication
Isoform 4 acts as a translational repressor for GLI1.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei97Involved in RNA bindingBy similarity1
Sitei120Involved in RNA bindingBy similarity1
Sitei124Involved in RNA bindingBy similarity1
Sitei130Involved in RNA bindingBy similarity1
Sitei190Involved in RNA bindingBy similarity1
Sitei193Involved in RNA bindingBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, RNA-binding
Biological processDifferentiation, mRNA processing, mRNA splicing, mRNA transport, Translation regulation, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein quaking
Short name:
MqkI
Short name:
qkI
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Qki
Synonyms:Qk, Qk1, Qka1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97837 Qk

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Qki are the cause of quakingviable (qkv). Qkv is a spontaneous mutation resulting in hypomyelinization of the central and peripheral nervous systems. Mutant mice develop normally until postnatal day 10 when they display rapid tremors or 'quaking' that is especially pronounced in hindlimbs and experience convulsive tonic-clonic seizures as they mature (PubMed:8589716). Mice with qkv specifically lack isoform 3 and isoform 4 in myelin-forming cells, while isoform 1 is lacking in oligodendrocytes of severely affected tracts (PubMed:12888522). Mice with qkv also lack the PRKN gene product, suggesting that the absence of PRKN may also affect the phenotype (PubMed:15014970).3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi48E → G in qk-Kt4; induces embryonic lethality possibly due to its inability to homodimerize. 3 Publications1
Mutagenesisi157V → E in qk-k24; induces embryonic lethality possibly due to blood vessel defects; prevents RNA-binding but not homodimerization. 3 Publications1
Mutagenesisi276 – 279PPGP → AAGA: Strongly impairs phosphorylation. 1 Publication4
Mutagenesisi285Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-288; F-290; F-292 and F-303. 1 Publication1
Mutagenesisi288Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-290; F-292 and F-303. 1 Publication1
Mutagenesisi290Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-292 and F-303. 1 Publication1
Mutagenesisi292Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-290 and F-303. 1 Publication1
Mutagenesisi303Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-290 and F-292. 1 Publication1
Mutagenesisi324R → A: Abolishes nuclear localization; when associated with A-330. 1 Publication1
Mutagenesisi328Y → F: Does not affect nuclear localization. 1 Publication1
Mutagenesisi330R → A: Abolishes nuclear localization; when associated with A-324. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002393741 – 341Protein quakingAdd BLAST341

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei188PhosphoserineBy similarity1
Modified residuei227Omega-N-methylarginineCombined sources1
Modified residuei242Asymmetric dimethylarginine; by CARM1; alternateBy similarity1
Modified residuei242Omega-N-methylarginine; alternateCombined sources1
Modified residuei256Omega-N-methylarginineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Methylated by PRMT1.1 Publication
Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA. The level of Tyr phosphorylation in the developing myelin is highest in the first postnatal week (P7). During the vigorous accumulation of MBP mRNA between P7 and P20, phosphorylation in the developing myelin drastically declines. By the end of the fourth postnatal week (P28), phosphorylation is reduced approximately 90%.2 Publications

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9QYS9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QYS9

PeptideAtlas

More...
PeptideAtlasi
Q9QYS9

PRoteomics IDEntifications database

More...
PRIDEi
Q9QYS9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QYS9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QYS9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in myelin-forming cells. Expressed in oligodendrocytes and astrocytes in the central nervous system as well as Schwann cells in the peripheral nervous system. Also expressed in the yolk sac endoderm, adjacent to the mesodermal site of developing blood islands, where the differentiation of blood and endothelial cells first occurs (at protein level). Expressed in brain, lung, heart and testis.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in neural progenitors of the ventricular zone (vz) during CNS development, but that expression is down-regulated during neuronal differentiation. By contrast, neural progenitors located in specific subdomains of the vz maintain expression as they differentiate and migrate away into the emerging nervous system. These have characteristics consistent with the acquisition of a glial rather than neuronal fate (at protein level) First detected in the neuroepithelium of the head folds at 7.5 dpc. Expression is strongly present ventrally in the nascent brain and neural tube of 8.5 dpc and 9.5 dpc and in the heart of 8.5 dpc. Isoform 1 is expressed in early embryos, while isoform 3 and isoform 4 are found in late development when myelination begins.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000062078 Expressed in sciatic nerve and 310 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QYS9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QYS9 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Does not require RNA to homodimerize (PubMed:10506177, PubMed:11297509, PubMed:9671495). Able to heterodimerize with BICC1 (PubMed:9315629).

4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
202529, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9QYS9, 3 interactors

Molecular INTeraction database

More...
MINTi
Q9QYS9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000095025

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9QYS9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1341
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QYS9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini87 – 153KHAdd BLAST67

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni11 – 82Qua1 domain; involved in homodimerizationBy similarityAdd BLAST72
Regioni182 – 213Qua2 domain; involved in RNA bindingBy similarityAdd BLAST32

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi276 – 279SH3-binding4
Motifi324 – 330Nuclear localization signal7

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KH domain and the Qua2 region are involved in RNA binding.By similarity

Keywords - Domaini

SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1588 Eukaryota
COG5176 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155310

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_046595_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QYS9

KEGG Orthology (KO)

More...
KOi
K14945

Identification of Orthologs from Complete Genome Data

More...
OMAi
XAEGEDS

Database of Orthologous Groups

More...
OrthoDBi
1565749at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QYS9

TreeFam database of animal gene trees

More...
TreeFami
TF314878

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1370.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR032367 Quaking_NLS
IPR032377 STAR_dimer

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00013 KH_1, 1 hit
PF16551 Quaking_NLS, 1 hit
PF16544 STAR_dimer, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00322 KH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54791 SSF54791, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QYS9-1) [UniParc]FASTAAdd to basket
Also known as: QKI-5

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVGEMETKEK PKPTPDYLMQ LMNDKKLMSS LPNFCGIFNH LERLLDEEIS
60 70 80 90 100
RVRKDMYNDT LNGSTEKRSA ELPDAVGPIV QLQEKLYVPV KEYPDFNFVG
110 120 130 140 150
RILGPRGLTA KQLEAETGCK IMVRGKGSMR DKKKEEQNRG KPNWEHLNED
160 170 180 190 200
LHVLITVEDA QNRAEIKLKR AVEEVKKLLV PAAEGEDSLK KMQLMELAIL
210 220 230 240 250
NGTYRDANIK SPALAFSLAA TAQAAPRIIT GPAPVLPPAA LRTPTPAGPT
260 270 280 290 300
IMPLIRQIQT AVMPNGTPHP TAAIVPPGPE AGLIYTPYEY PYTLAPATSI
310 320 330 340
LEYPIEPSGV LGAVATKVRR HDMRVHPYQR IVTADRAATG N
Length:341
Mass (Da):37,671
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i43E7F3A426A494C4
GO
Isoform 2 (identifier: Q9QYS9-2) [UniParc]FASTAAdd to basket
Also known as: QKI-7B

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → VWLSQRKAKNSRTVLTEPSSDLNLTNA

Show »
Length:338
Mass (Da):37,352
Checksum:iEC8C3DBF62F7788C
GO
Isoform 3 (identifier: Q9QYS9-3) [UniParc]FASTAAdd to basket
Also known as: QkI-7

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

Show »
Length:325
Mass (Da):35,978
Checksum:iB4B2DA898F0145B3
GO
Isoform 4 (identifier: Q9QYS9-4) [UniParc]FASTAAdd to basket
Also known as: QKI-6, QKI-5B

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GMAFPTKG

Show »
Length:319
Mass (Da):35,131
Checksum:iD1427E54B0BF54E7
GO
Isoform 5 (identifier: Q9QYS9-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     183-187: AEGED → VSKFS
     188-341: Missing.

Show »
Length:187
Mass (Da):21,425
Checksum:i48E9008C98E4E18B
GO
Isoform 6 (identifier: Q9QYS9-6) [UniParc]FASTAAdd to basket
Also known as: QKI-7B

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → VWLSQRKAKNSRTVLTEPSSDLNLTNA

Show »
Length:330
Mass (Da):36,607
Checksum:iD796B25FA5782A1E
GO
Isoform 7 (identifier: Q9QYS9-7) [UniParc]FASTAAdd to basket
Also known as: QKI-5A

The sequence of this isoform differs from the canonical sequence as follows:
     341-341: N → NVNW

Show »
Length:344
Mass (Da):38,070
Checksum:i9B712023E7F3A426
GO
Isoform 8 (identifier: Q9QYS9-8) [UniParc]FASTAAdd to basket
Also known as: QKI-G

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GKYDSCTM

Show »
Length:319
Mass (Da):35,227
Checksum:iDFB0F14663C9D147
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B2WCH2A0A3B2WCH2_MOUSE
Quaking
Qk
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti276P → A in BAB23859 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019192183 – 187AEGED → VSKFS in isoform 5. Curated5
Alternative sequenceiVSP_019193188 – 341Missing in isoform 5. CuratedAdd BLAST154
Alternative sequenceiVSP_019194213 – 220Missing in isoform 6. Curated8
Alternative sequenceiVSP_019195312 – 341GAVAT…AATGN → VWLSQRKAKNSRTVLTEPSS DLNLTNA in isoform 2 and isoform 6. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_019196312 – 341GAVAT…AATGN → EWIEMPVMPDISAH in isoform 3. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_019197312 – 341GAVAT…AATGN → GMAFPTKG in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_019198312 – 341GAVAT…AATGN → GKYDSCTM in isoform 8. CuratedAdd BLAST30
Alternative sequenceiVSP_019199341N → NVNW in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U44940 mRNA Translation: AAC52491.1
AF090402 mRNA Translation: AAC99452.1
AF090403 mRNA Translation: AAC99453.1
AF090404 mRNA Translation: AAC99454.1
AF091047 mRNA Translation: AAC63042.1
AF090401 AF090400 Genomic DNA Translation: AAD53329.1
AF090397 AF090396 Genomic DNA Translation: AAD53330.1
AF090397 AF090394 Genomic DNA Translation: AAD53331.1
AF090396 AF090395 Genomic DNA Translation: AAD53332.1
AF467890 Genomic DNA Translation: AAM21006.1
AF467890 Genomic DNA Translation: AAM21007.1
AF467890 Genomic DNA Translation: AAM21008.1
AF467890 Genomic DNA Translation: AAM21009.1
AF467890 Genomic DNA Translation: AAM21010.1
AK005169 mRNA Translation: BAB23859.1
AK132303 mRNA Translation: BAE21091.1
BC053426 mRNA Translation: AAH53426.1
BC056346 mRNA Translation: AAH56346.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37614.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37615.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37616.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28387.1 [Q9QYS9-3]
CCDS49947.1 [Q9QYS9-1]
CCDS88989.1 [Q9QYS9-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001152988.1, NM_001159516.1 [Q9QYS9-4]
NP_001152989.1, NM_001159517.1 [Q9QYS9-1]
NP_068681.1, NM_021881.2 [Q9QYS9-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042296; ENSMUSP00000046740; ENSMUSG00000062078 [Q9QYS9-3]
ENSMUST00000097414; ENSMUSP00000095025; ENSMUSG00000062078 [Q9QYS9-4]
ENSMUST00000233645; ENSMUSP00000156511; ENSMUSG00000062078 [Q9QYS9-1]
ENSMUST00000233828; ENSMUSP00000156665; ENSMUSG00000062078 [Q9QYS9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
19317

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:19317

UCSC genome browser

More...
UCSCi
uc008akb.2 mouse [Q9QYS9-1]
uc008ake.2 mouse [Q9QYS9-4]
uc012ajv.1 mouse [Q9QYS9-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44940 mRNA Translation: AAC52491.1
AF090402 mRNA Translation: AAC99452.1
AF090403 mRNA Translation: AAC99453.1
AF090404 mRNA Translation: AAC99454.1
AF091047 mRNA Translation: AAC63042.1
AF090401 AF090400 Genomic DNA Translation: AAD53329.1
AF090397 AF090396 Genomic DNA Translation: AAD53330.1
AF090397 AF090394 Genomic DNA Translation: AAD53331.1
AF090396 AF090395 Genomic DNA Translation: AAD53332.1
AF467890 Genomic DNA Translation: AAM21006.1
AF467890 Genomic DNA Translation: AAM21007.1
AF467890 Genomic DNA Translation: AAM21008.1
AF467890 Genomic DNA Translation: AAM21009.1
AF467890 Genomic DNA Translation: AAM21010.1
AK005169 mRNA Translation: BAB23859.1
AK132303 mRNA Translation: BAE21091.1
BC053426 mRNA Translation: AAH53426.1
BC056346 mRNA Translation: AAH56346.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37614.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37615.1
AJ012812 AJ012815 Genomic DNA Translation: CAB37616.1
CCDSiCCDS28387.1 [Q9QYS9-3]
CCDS49947.1 [Q9QYS9-1]
CCDS88989.1 [Q9QYS9-4]
RefSeqiNP_001152988.1, NM_001159516.1 [Q9QYS9-4]
NP_001152989.1, NM_001159517.1 [Q9QYS9-1]
NP_068681.1, NM_021881.2 [Q9QYS9-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4DNNX-ray2.10A/B14-67[»]
SMRiQ9QYS9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi202529, 3 interactors
IntActiQ9QYS9, 3 interactors
MINTiQ9QYS9
STRINGi10090.ENSMUSP00000095025

PTM databases

iPTMnetiQ9QYS9
PhosphoSitePlusiQ9QYS9

Proteomic databases

EPDiQ9QYS9
PaxDbiQ9QYS9
PeptideAtlasiQ9QYS9
PRIDEiQ9QYS9

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
20048 389 antibodies

Genome annotation databases

EnsembliENSMUST00000042296; ENSMUSP00000046740; ENSMUSG00000062078 [Q9QYS9-3]
ENSMUST00000097414; ENSMUSP00000095025; ENSMUSG00000062078 [Q9QYS9-4]
ENSMUST00000233645; ENSMUSP00000156511; ENSMUSG00000062078 [Q9QYS9-1]
ENSMUST00000233828; ENSMUSP00000156665; ENSMUSG00000062078 [Q9QYS9-4]
GeneIDi19317
KEGGimmu:19317
UCSCiuc008akb.2 mouse [Q9QYS9-1]
uc008ake.2 mouse [Q9QYS9-4]
uc012ajv.1 mouse [Q9QYS9-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
19317
MGIiMGI:97837 Qk

Phylogenomic databases

eggNOGiKOG1588 Eukaryota
COG5176 LUCA
GeneTreeiENSGT00940000155310
HOGENOMiCLU_046595_2_0_1
InParanoidiQ9QYS9
KOiK14945
OMAiXAEGEDS
OrthoDBi1565749at2759
PhylomeDBiQ9QYS9
TreeFamiTF314878

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Qk mouse

Protein Ontology

More...
PROi
PR:Q9QYS9
RNActiQ9QYS9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000062078 Expressed in sciatic nerve and 310 other tissues
ExpressionAtlasiQ9QYS9 baseline and differential
GenevisibleiQ9QYS9 MM

Family and domain databases

Gene3Di3.30.1370.10, 1 hit
InterProiView protein in InterPro
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR032367 Quaking_NLS
IPR032377 STAR_dimer
PfamiView protein in Pfam
PF00013 KH_1, 1 hit
PF16551 Quaking_NLS, 1 hit
PF16544 STAR_dimer, 1 hit
SMARTiView protein in SMART
SM00322 KH, 1 hit
SUPFAMiSSF54791 SSF54791, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiQKI_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QYS9
Secondary accession number(s): O88972
, Q61110, Q78ZE4, Q78ZE5, Q8K4X9, Q8K4Y0, Q9CW34, Q9QUH4, Q9R2A8, Q9Z246
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 1, 2000
Last modified: April 22, 2020
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again