Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (02 Dec 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

B-cell lymphoma/leukemia 11A

Gene

Bcl11a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in hematopoiesis. Essential factor in lymphopoiesis, required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri170 – 193C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri377 – 399C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 429C2H2-type 3PROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
B-cell lymphoma/leukemia 11A
Short name:
BCL-11A
Alternative name(s):
B-cell CLL/lymphoma 11A
COUP-TF-interacting protein 1
Ecotropic viral integration site 9 protein
Short name:
EVI-9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Bcl11a
Synonyms:Ctip1, Evi9, Kiaa1809
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:106190, Bcl11a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Germline biallelic loss of Bcl11a leads to perinatal lethality. Bcl11a +/- mice have a significantly decreased brain volume, affecting both gray and white matter. The limbic system (hippocampus and amygdala) is among the brain regions that are more severely affected. Bcl11a +/- mice display normal novelty-seeking behavior but show long-term social memory defects, impaired sociability, and increased physical activity. Bcl11a +/- mice show dynamic postnatal transcriptional dysregulation in the brain.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi123K → R: No effect on sumoylation. 1 Publication1
Mutagenesisi637K → R: Abolishes sumoylation. No effect on nuclear body location. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471031 – 773B-cell lymphoma/leukemia 11AAdd BLAST773

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei86PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki164Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei205PhosphoserineBy similarity1
Modified residuei271Asymmetric dimethylarginineCombined sources1
Modified residuei332PhosphoserineCombined sources1
Modified residuei337PhosphoserineCombined sources1
Modified residuei446PhosphoserineCombined sources1
Modified residuei447PhosphoserineCombined sources1
Modified residuei608PhosphoserineCombined sources1
Cross-linki620Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei625PhosphoserineCombined sources1
Modified residuei630PhosphoserineCombined sources1
Cross-linki634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)1 Publication
Modified residuei701PhosphothreonineCombined sources1
Isoform 6 (identifier: Q9QYE3-14)
Modified residuei162PhosphothreonineCombined sources1
Isoform 5 (identifier: Q9QYE3-13)
Modified residuei214PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated with SUMO1.1 Publication

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QYE3

PeptideAtlas

More...
PeptideAtlasi
Q9QYE3

PRoteomics IDEntifications database

More...
PRIDEi
Q9QYE3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QYE3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QYE3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoforms are expressed in a tissue-specific fashion. Isoforms 1, isoform 2, and isoform 3 are expressed at similar levels in testis, kidney and spleen. Isoform 1 is expressed in the stomach, and isoform 2 is expressed exclusively in the lung. Overexpression following proviral integration in hematopoietic cells results in the generation of myeloid leukemia.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in the developing embryo. Expressed in developing brain from 10.5 dpc, with highest expression in the forebrain between 12.5 dpc and 14.5 dpc. Central nervous system expression persists throughout the post-natal period in the cortex, hippocampus, olfactory buld, and, to a lesser extent, in the cerebellum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000000861, Expressed in rostral migratory stream and 279 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QYE3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QYE3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TFCOUP1, PIAS3, ARP1 and EAR2.

Interacts with TBR1 (By similarity).

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
199546, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9QYE3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000000881

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9QYE3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QYE3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 210Required for nuclear body formation and for SUMO1 recruitmentAdd BLAST210

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi260 – 373Pro-richAdd BLAST114
Compositional biasi481 – 509Glu-richAdd BLAST29

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus is involved in protein dimerization and in transactivation of transcription.By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri170 – 193C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri377 – 399C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 429C2H2-type 3PROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156983

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1237453_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QYE3

Database of Orthologous Groups

More...
OrthoDBi
224109at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QYE3

TreeFam database of animal gene trees

More...
TreeFami
TF318131

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096, zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355, ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667, SSF57667, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 3 hits
PS50157, ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QYE3-1) [UniParc]FASTAAdd to basket
Also known as: a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ
60 70 80 90 100
CQMNFPLGDI LIFIEHKRKQ CNGSLCLEKG VDKPPSPSPI EMKKASNPVE
110 120 130 140 150
VGIQVTPEDD DCLSTSSRGI CPKQEHIADK LLHWRGLSSP RSAHGALIPT
160 170 180 190 200
PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT SAWFLLQHAQ NTHGLRIYLE
210 220 230 240 250
SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL LRIPGSVSRE
260 270 280 290 300
ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV
310 320 330 340 350
LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS
360 370 380 390 400
KPPFLATPPL PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT
410 420 430 440 450
GEKPYKCNLC DHACTQASKL KRHMKTHMHK SSPMTVKSDD GLSTASSPEP
460 470 480 490 500
GTSDLVGSAS SALKSVVAKF KSENDPNLIP ENGDEEEEED DEEEEEEEEE
510 520 530 540 550
EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDEG RALPDVMQGM
560 570 580 590 600
VLSSMQHFSE AFHQVLGEKH KRSHLAEAEG HRDTCDEDSV AGESDRIDDG
610 620 630 640 650
TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP
660 670 680 690 700
NTENVYSQWL AGYAASRQLK DPFLTFGDSR QSPFASSSEH SSENGSLRFS
710 720 730 740 750
TPPGELDGGI SGRSGTGSGG STPHISGPGP GRPSSKEGRR SDTCPSHTPV
760 770
RRSTPRAQDV WQFSDGSSRT LKF
Length:773
Mass (Da):83,855
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3BD10B7F14AA9EC4
GO
Isoform 2 (identifier: Q9QYE3-10) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.
     726-773: Missing.

Show »
Length:439
Mass (Da):47,399
Checksum:i120BF060E661E99B
GO
Isoform 3 (identifier: Q9QYE3-11) [UniParc]FASTAAdd to basket
Also known as: c

The sequence of this isoform differs from the canonical sequence as follows:
     212-744: Missing.

Show »
Length:240
Mass (Da):26,553
Checksum:i569B5B4CC3C20E2E
GO
Isoform 4 (identifier: Q9QYE3-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.
     745-773: PSHTPVRRSTPRAQDVWQFSDGSSRTLKF → EYCGKVFKNC...RVLNNDIKTE

Show »
Length:412
Mass (Da):44,826
Checksum:i1A2AFD70252887C1
GO
Isoform 5 (identifier: Q9QYE3-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.

Show »
Length:243
Mass (Da):26,824
Checksum:iB19C19FD90473679
GO
Isoform 6 (identifier: Q9QYE3-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.

Show »
Length:191
Mass (Da):21,075
Checksum:i23B17797A92CF20B
GO
Isoform 7 (identifier: Q9QYE3-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-773: Missing.

Show »
Length:130
Mass (Da):14,310
Checksum:iE9335B3326D95236
GO
Isoform 8 (identifier: Q9QYE3-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.

Show »
Length:487
Mass (Da):52,639
Checksum:iC96493A37D33CDC0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5STS9Q5STS9_MOUSE
B-cell lymphoma/leukemia 11A
Bcl11a
835Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF63682 differs from that shown. Reason: Frameshift.Curated
The sequence BAC65839 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti104Q → K in BAB23285 (PubMed:16141072).Curated1
Sequence conflicti129D → G in BAC65839 (PubMed:12693553).Curated1
Sequence conflicti211V → G in AAF65929 (PubMed:10757802).Curated1
Sequence conflicti673F → L in AAF63682 (PubMed:10744719).Curated1
Sequence conflicti699F → L in AAF65928 (PubMed:10757802).Curated1
Sequence conflicti743T → I in AAF63682 (PubMed:10744719).Curated1
Sequence conflicti773F → L in AAF63682 (PubMed:10744719).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0095561 – 423Missing in isoform 4. 1 PublicationAdd BLAST423
Alternative sequenceiVSP_0095571 – 286Missing in isoform 2 and isoform 8. 2 PublicationsAdd BLAST286
Alternative sequenceiVSP_0095581 – 52Missing in isoform 6. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_009559131 – 773Missing in isoform 7. 1 PublicationAdd BLAST643
Alternative sequenceiVSP_009560212 – 744Missing in isoform 3. 1 PublicationAdd BLAST533
Alternative sequenceiVSP_009561212 – 243GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAQEPLSSEKL in isoform 5 and isoform 6. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_009562244 – 773Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST530
Alternative sequenceiVSP_009563726 – 773Missing in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_009564745 – 773PSHTP…RTLKF → EYCGKVFKNCSNLTVHRRSH TGERPYKCELCNYACAQSSK LTRHMKTHGQVGKDVYKCEI CKMPFSVYSTLEKHMKKWHS DRVLNNDIKTE in isoform 4. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF051525 mRNA Translation: AAF22430.1
AF169036 mRNA Translation: AAF65928.1
AF169037 mRNA Translation: AAF65929.1
AF186018 mRNA Translation: AAF63682.1 Frameshift.
AK004395 mRNA Translation: BAB23285.1
AK043677 mRNA Translation: BAC31616.1
AK045556 mRNA Translation: BAC32416.1
AK049700 mRNA Translation: BAC33881.1
AK122557 mRNA Translation: BAC65839.1 Different initiation.
BC010585 mRNA Translation: AAH10585.1
BC051418 mRNA Translation: AAH51418.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24483.1 [Q9QYE3-1]
CCDS48758.1 [Q9QYE3-13]
CCDS48759.1 [Q9QYE3-14]

Protein sequence database of the Protein Information Resource

More...
PIRi
PT0706

NCBI Reference Sequences

More...
RefSeqi
NP_001152761.1, NM_001159289.1 [Q9QYE3-13]
NP_001152762.1, NM_001159290.1 [Q9QYE3-14]
NP_001229863.1, NM_001242934.1
NP_057916.1, NM_016707.3 [Q9QYE3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861 [Q9QYE3-1]
ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861 [Q9QYE3-13]
ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861 [Q9QYE3-14]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14025

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14025

UCSC genome browser

More...
UCSCi
uc007ifs.2, mouse [Q9QYE3-15]
uc007ifu.2, mouse [Q9QYE3-1]
uc007ifv.2, mouse [Q9QYE3-13]
uc007ifw.2, mouse [Q9QYE3-14]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF051525 mRNA Translation: AAF22430.1
AF169036 mRNA Translation: AAF65928.1
AF169037 mRNA Translation: AAF65929.1
AF186018 mRNA Translation: AAF63682.1 Frameshift.
AK004395 mRNA Translation: BAB23285.1
AK043677 mRNA Translation: BAC31616.1
AK045556 mRNA Translation: BAC32416.1
AK049700 mRNA Translation: BAC33881.1
AK122557 mRNA Translation: BAC65839.1 Different initiation.
BC010585 mRNA Translation: AAH10585.1
BC051418 mRNA Translation: AAH51418.1
CCDSiCCDS24483.1 [Q9QYE3-1]
CCDS48758.1 [Q9QYE3-13]
CCDS48759.1 [Q9QYE3-14]
PIRiPT0706
RefSeqiNP_001152761.1, NM_001159289.1 [Q9QYE3-13]
NP_001152762.1, NM_001159290.1 [Q9QYE3-14]
NP_001229863.1, NM_001242934.1
NP_057916.1, NM_016707.3 [Q9QYE3-1]

3D structure databases

SMRiQ9QYE3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi199546, 3 interactors
IntActiQ9QYE3, 1 interactor
STRINGi10090.ENSMUSP00000000881

PTM databases

iPTMnetiQ9QYE3
PhosphoSitePlusiQ9QYE3

Proteomic databases

PaxDbiQ9QYE3
PeptideAtlasiQ9QYE3
PRIDEiQ9QYE3

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30518, 445 antibodies

Genome annotation databases

EnsembliENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861 [Q9QYE3-1]
ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861 [Q9QYE3-13]
ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861 [Q9QYE3-14]
GeneIDi14025
KEGGimmu:14025
UCSCiuc007ifs.2, mouse [Q9QYE3-15]
uc007ifu.2, mouse [Q9QYE3-1]
uc007ifv.2, mouse [Q9QYE3-13]
uc007ifw.2, mouse [Q9QYE3-14]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
53335
MGIiMGI:106190, Bcl11a

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000156983
HOGENOMiCLU_1237453_0_0_1
InParanoidiQ9QYE3
OrthoDBi224109at2759
PhylomeDBiQ9QYE3
TreeFamiTF318131

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
14025, 0 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Bcl11a, mouse

Protein Ontology

More...
PROi
PR:Q9QYE3
RNActiQ9QYE3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000000861, Expressed in rostral migratory stream and 279 other tissues
ExpressionAtlasiQ9QYE3, baseline and differential
GenevisibleiQ9QYE3, MM

Family and domain databases

InterProiView protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00096, zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 3 hits
SUPFAMiSSF57667, SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 3 hits
PS50157, ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBC11A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QYE3
Secondary accession number(s): Q80T89
, Q8BLC7, Q8BLR4, Q8BWX3, Q921V4, Q9D0V2, Q9JIT4, Q9JLK8, Q9JLK9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: May 1, 2000
Last modified: December 2, 2020
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again