Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-adducin

Gene

Add2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5223345 Miscellaneous transport and binding events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-adducin
Alternative name(s):
Add97
Erythrocyte adducin subunit beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Add2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:87919 Add2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002185341 – 725Beta-adducinAdd BLAST725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei11PhosphoserineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei55PhosphothreonineBy similarity1
Modified residuei60PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei532PhosphoserineCombined sources1
Modified residuei533PhosphothreonineCombined sources1
Modified residuei535PhosphoserineCombined sources1
Modified residuei594PhosphoserineCombined sources1
Modified residuei598PhosphoserineCombined sources1
Modified residuei602PhosphoserineCombined sources1
Modified residuei606PhosphoserineCombined sources1
Modified residuei612PhosphothreonineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei620PhosphoserineCombined sources1
Modified residuei674PhosphothreonineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei685PhosphoserineBy similarity1
Modified residuei688PhosphoserineCombined sources1
Modified residuei692PhosphoserineCombined sources1
Modified residuei696PhosphoserineCombined sources1
Modified residuei698PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Modified residuei702PhosphoserineBy similarity1
Modified residuei712PhosphoserineBy similarity1
Isoform 2 (identifier: Q9QYB8-2)
Modified residuei561PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9QYB8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QYB8

PeptideAtlas

More...
PeptideAtlasi
Q9QYB8

PRoteomics IDEntifications database

More...
PRIDEi
Q9QYB8

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
Q9QYB8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QYB8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QYB8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000030000 Expressed in 214 organ(s), highest expression level in dentate gyrus of hippocampal formation

CleanEx database of gene expression profiles

More...
CleanExi
MM_ADD2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QYB8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QYB8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 (By similarity). Heterodimer of an alpha and a beta subunit.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
197982, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9QYB8, 3 interactors

Molecular INTeraction database

More...
MINTi
Q9QYB8

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000032069

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9QYB8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QYB8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni425 – 444Interaction with calmodulinSequence analysisAdd BLAST20
Regioni703 – 720Interaction with calmodulinSequence analysisAdd BLAST18

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3699 Eukaryota
COG0235 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159299

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004180

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QYB8

KEGG Orthology (KO)

More...
KOi
K18622

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFVQEKA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0324

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QYB8

TreeFam database of animal gene trees

More...
TreeFami
TF313003

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.225.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027773 ADD2
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10672:SF6 PTHR10672:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00596 Aldolase_II, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01007 Aldolase_II, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53639 SSF53639, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QYB8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ
60 70 80 90 100
KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA
110 120 130 140 150
VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA
160 170 180 190 200
QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS
210 220 230 240 250
CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA
260 270 280 290 300
LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE
310 320 330 340 350
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS
360 370 380 390 400
TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI
410 420 430 440 450
PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ
460 470 480 490 500
RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN
510 520 530 540 550
KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLMSK GDADTKDESE
560 570 580 590 600
ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDIATE KPGSPVKSTP
610 620 630 640 650
ASPVQSPSKA GTKSPAVSPS KTSEDTKKTE VSEANTEPEP VKPEGLVVNG
660 670 680 690 700
KEEEPSVEEA LSKGLGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS
710 720
PSKKKKKFRT PSFLKKSKKK EKVES
Length:725
Mass (Da):80,642
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i479153AB1BD6C0DA
GO
Isoform 2 (identifier: Q9QYB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP
     563-725: Missing.

Show »
Length:562
Mass (Da):62,816
Checksum:iAECF298E23B44CB8
GO
Isoform 3 (identifier: Q9QYB8-3) [UniParc]FASTAAdd to basket
Also known as: Delta

The sequence of this isoform differs from the canonical sequence as follows:
     284-531: Missing.

Show »
Length:477
Mass (Da):52,522
Checksum:iA15E5687AFD48EF0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0N4SWF0A0A0N4SWF0_MOUSE
Beta-adducin
Add2
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti219R → T in AAF29503 (PubMed:10845937).Curated1
Sequence conflicti469E → Q in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti469E → Q in AAF24973 (PubMed:10602987).Curated1
Sequence conflicti518Q → H in BAC25943 (PubMed:16141072).Curated1
Sequence conflicti634A → R in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti666G → V in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti675D → V in AAF29502 (PubMed:10845937).Curated1
Sequence conflicti675D → V in AAF29503 (PubMed:10845937).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022596284 – 531Missing in isoform 3. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_000184532 – 562STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_000185563 – 725Missing in isoform 2. 2 PublicationsAdd BLAST163

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF100422 mRNA Translation: AAF24972.1
AF100423 mRNA Translation: AAF24973.1
AF189769 mRNA Translation: AAF29502.1
AF189770 mRNA Translation: AAF29503.1
AK014496 mRNA Translation: BAB29395.1
AK028425 mRNA Translation: BAC25943.1
AK156954 mRNA Translation: BAE33913.1
BC046783 mRNA Translation: AAH46783.1
BC053032 mRNA Translation: AAH53032.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20308.1 [Q9QYB8-1]
CCDS85085.1 [Q9QYB8-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A60670

NCBI Reference Sequences

More...
RefSeqi
NP_001258786.1, NM_001271857.1 [Q9QYB8-1]
NP_001258787.1, NM_001271858.1 [Q9QYB8-1]
NP_001258788.1, NM_001271859.1 [Q9QYB8-1]
NP_001258789.1, NM_001271860.1 [Q9QYB8-2]
NP_001258790.1, NM_001271861.1 [Q9QYB8-2]
NP_038486.2, NM_013458.5 [Q9QYB8-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.104155
Mm.489430

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203196; ENSMUSP00000145104; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203279; ENSMUSP00000145452; ENSMUSG00000030000 [Q9QYB8-3]
ENSMUST00000203366; ENSMUSP00000144849; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203724; ENSMUSP00000145296; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203786; ENSMUSP00000144694; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000204059; ENSMUSP00000145160; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000205034; ENSMUSP00000145034; ENSMUSG00000030000 [Q9QYB8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11519

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:11519

UCSC genome browser

More...
UCSCi
uc009crd.2 mouse [Q9QYB8-2]
uc009cre.2 mouse [Q9QYB8-1]
uc012eoj.2 mouse [Q9QYB8-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100422 mRNA Translation: AAF24972.1
AF100423 mRNA Translation: AAF24973.1
AF189769 mRNA Translation: AAF29502.1
AF189770 mRNA Translation: AAF29503.1
AK014496 mRNA Translation: BAB29395.1
AK028425 mRNA Translation: BAC25943.1
AK156954 mRNA Translation: BAE33913.1
BC046783 mRNA Translation: AAH46783.1
BC053032 mRNA Translation: AAH53032.1
CCDSiCCDS20308.1 [Q9QYB8-1]
CCDS85085.1 [Q9QYB8-2]
PIRiA60670
RefSeqiNP_001258786.1, NM_001271857.1 [Q9QYB8-1]
NP_001258787.1, NM_001271858.1 [Q9QYB8-1]
NP_001258788.1, NM_001271859.1 [Q9QYB8-1]
NP_001258789.1, NM_001271860.1 [Q9QYB8-2]
NP_001258790.1, NM_001271861.1 [Q9QYB8-2]
NP_038486.2, NM_013458.5 [Q9QYB8-1]
UniGeneiMm.104155
Mm.489430

3D structure databases

ProteinModelPortaliQ9QYB8
SMRiQ9QYB8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi197982, 1 interactor
IntActiQ9QYB8, 3 interactors
MINTiQ9QYB8
STRINGi10090.ENSMUSP00000032069

PTM databases

iPTMnetiQ9QYB8
PhosphoSitePlusiQ9QYB8

2D gel databases

REPRODUCTION-2DPAGEiQ9QYB8

Proteomic databases

EPDiQ9QYB8
PaxDbiQ9QYB8
PeptideAtlasiQ9QYB8
PRIDEiQ9QYB8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203196; ENSMUSP00000145104; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203279; ENSMUSP00000145452; ENSMUSG00000030000 [Q9QYB8-3]
ENSMUST00000203366; ENSMUSP00000144849; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203724; ENSMUSP00000145296; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203786; ENSMUSP00000144694; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000204059; ENSMUSP00000145160; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000205034; ENSMUSP00000145034; ENSMUSG00000030000 [Q9QYB8-2]
GeneIDi11519
KEGGimmu:11519
UCSCiuc009crd.2 mouse [Q9QYB8-2]
uc009cre.2 mouse [Q9QYB8-1]
uc012eoj.2 mouse [Q9QYB8-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
119
MGIiMGI:87919 Add2

Phylogenomic databases

eggNOGiKOG3699 Eukaryota
COG0235 LUCA
GeneTreeiENSGT00940000159299
HOVERGENiHBG004180
InParanoidiQ9QYB8
KOiK18622
OMAiPFVQEKA
OrthoDBiEOG091G0324
PhylomeDBiQ9QYB8
TreeFamiTF313003

Enzyme and pathway databases

ReactomeiR-MMU-5223345 Miscellaneous transport and binding events

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9QYB8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000030000 Expressed in 214 organ(s), highest expression level in dentate gyrus of hippocampal formation
CleanExiMM_ADD2
ExpressionAtlasiQ9QYB8 baseline and differential
GenevisibleiQ9QYB8 MM

Family and domain databases

Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027773 ADD2
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF6 PTHR10672:SF6, 1 hit
PfamiView protein in Pfam
PF00596 Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007 Aldolase_II, 1 hit
SUPFAMiSSF53639 SSF53639, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADDB_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QYB8
Secondary accession number(s): Q3U0E1
, Q80VH9, Q8C1C4, Q9CXE3, Q9JLE4, Q9JLE5, Q9QYB7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 153 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again