Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (07 Oct 2020)
Sequence version 1 (01 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Z-DNA-binding protein 1

Gene

Zbp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key innate sensor that recognizes and binds Z-RNA structures, which are produced by a number of viruses, such as herpesvirus, orthomyxovirus or flavivirus, and triggers different forms of cell death (PubMed:17618271, PubMed:18375758, PubMed:19590578, PubMed:23283962, PubMed:27746097, PubMed:27917412, PubMed:27819681, PubMed:28716805, PubMed:28607035, PubMed:30050136, PubMed:31358656, PubMed:32200799, PubMed:32296175). Once activated upon Z-RNA-binding, ZBP1 interacts with RIPK3, inducing the complementary pathways of apoptosis, necroptosis and pyroptosis (PubMed:17618271, PubMed:19590578, PubMed:27746097, PubMed:27917412, PubMed:27819681, PubMed:28716805, PubMed:28607035, PubMed:29073079, PubMed:31358656, PubMed:32200799, PubMed:32296175). Acts as a key activator of necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members: ZBP1-dependent necroptosis involves RIPK3 stimulation, which phosphorylates and activates MLKL, triggering execution of programmed necrosis (PubMed:22423968, PubMed:27746097, PubMed:27819681, PubMed:27819682, PubMed:28716805, PubMed:32200799). In addition to TNF-induced necroptosis, necroptosis can also take place in the nucleus in response to orthomyxoviruses infection: ZBP1 recognizes and binds Z-RNA structures that are produced in infected nuclei by orthomyxoviruses, such as the influenza A virus (IAV), leading to ZBP1 activation, RIPK3 stimulation and subsequent MLKL phosphorylation, triggering disruption of the nuclear envelope and leakage of cellular DNA into the cytosol (PubMed:32200799, PubMed:32296175). ZBP1-dependent cell death in response to IAV infection promotes interleukin-1 alpha (IL1A) induction in an NLRP3-inflammasome-independent manner: IL1A expression is required for the optimal interleukin-1 beta (IL1B) production, and together, these cytokines promote infiltration of inflammatory neutrophils to the lung, leading to the formation of neutrophil extracellular traps (PubMed:31630209). In some cell types, also able to restrict viral replication by promoting cell death-independent responses (PubMed:30635240). In response to flavivirus infection in neurons, promotes a cell death-independent pathway that restricts viral replication: together with RIPK3, promotes a death-independent transcriptional program that modifies the cellular metabolism via up-regulation expression of the enzyme ACOD1/IRG1 and production of the metabolite itaconate (PubMed:30635240). Itaconate inhibits the activity of succinate dehydrogenase, generating a metabolic state in neurons that suppresses replication of viral genomes (PubMed:30635240).18 Publications

Caution

According to a report, mice lacking Zbp1 display reductions in respiratory epithelial damage and lung inflammation (PubMed:27917412). However, the virus persists and replicates in the infected cells leading to a delay in recovery from infection, but the animals are protected from mortality (PubMed:27917412). In contrast, another article reported increased mortality in knockout mice, probably caused by increased virus burden (PubMed:27746097). However, as this study did not assess the inflammatory response in the lungs, it is difficult to compare ZBP1 regulation of lung inflammation between these two studies (PubMed:27746097).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

ZBP1-dependent necroptosis is normally inhibited by RIPK1: RIPK1 inhibits the ZBP1-induced activation of RIPK3 via FADD-mediated recruitment of CASP8, which cleaves RIPK1 and limits TNF-induced necroptosis.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, RNA-binding
Biological processAntiviral defense, Apoptosis, Host-virus interaction, Immunity, Innate immunity, Necrosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Z-DNA-binding protein 1Curated
Alternative name(s):
DNA-dependent activator of IFN-regulatory factors1 Publication
Short name:
DAI1 Publication
Tumor stroma and activated macrophage protein DLM-11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Zbp1Imported
Synonyms:Dlm11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1927449, Zbp1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are resistant to necroptosis, characterized by a decrease in epithelial cell death and an increase in virus replication (PubMed:22423968, PubMed:27746097, PubMed:27917412). At a modestly lethal dose of influenza A virus (IAV), mice display significantly increased rates of mortality, probably caused by a failure to eliminate infected cells and limit virus spread in pulmonary tissue (PubMed:32200799). Perinatal lethality observed in Ripk1 knockout mice is rescued in knockout mice lacking both Ripk1 and Zbp1 (PubMed:27819681, PubMed:27819682). Skin inflammation observed in Ripk1(mRHIM) mutant mice is abrogated in Ripk1(mRHIM) mutant mice that also lack Zbp1 (PubMed:27819681).6 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi46 – 50NQVLY → DQVLA in ZBP1(Zalpha1); no effect. In ZBP1(Zalpha1-Zalpha2); knockin mice are viable and develop mild skin lesions in response to influenza A virus (IAV); mice are protected from the activation of RIPK3 and MLKL as well as the cell death; when associated with 122-D--A-126. 4 Publications5
Mutagenesisi122 – 126NPLLY → DPLLA in ZBP1(Zalpha2); abolished ability to sense influenza A virus (IAV) Z-RNAs. In ZBP1(Zalpha2); knockin mice are viable and develop mild skin lesions in response to influenza A virus (IAV). ZBP1(Zalpha2) knockin mice are protected from the activation of RIPK3 and MLKL as well as the cell death. In ZBP1(Zalpha1-Zalpha2); knockin mice are viable and develop mild skin lesions in response to influenza A virus (IAV); mice are protected from the activation of RIPK3 and MLKL as well as the cell death; when associated with 46-D--A-50. 5 Publications5
Mutagenesisi192 – 195IQIG → AAAA in mRHIMA; abolished interaction with RIPK3 and subsequent necroptosis. In ZBP1(Mr1) knockin mice are viable and do not develop skin inflammation in response to lethal dose of influenza A virus (IAV). 4 Publications4
Mutagenesisi248 – 251VQLG → AAAA in mRHIMB; does not affect ability to induce necroptosis. 2 Publications4
Mutagenesisi352 – 353SS → AA: Does not greatly affect phosphorylation status. 1 Publication2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000665651 – 411Z-DNA-binding protein 1Add BLAST411

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki17Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki43Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated; polyubiquitinated following influenza A virus (IAV) infection.1 Publication
Phosphorylated.1 Publication

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9QY24

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9QY24

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QY24

PRoteomics IDEntifications database

More...
PRIDEi
Q9QY24

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QY24

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QY24

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lung, spleen and liver. Lower levels were seen in heart, kidney and testis. Expression is greatly up-regulated in tumor stromal cells and activated macrophages.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression is activated by IRF1 (PubMed:29321274). Up-regulated following interferon treatment (PubMed:10564822, PubMed:29073079). By lipopolysaccharides (LPS) (PubMed:10564822).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027514, Expressed in duodenum and 123 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QY24, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QY24, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:18375758).

Interacts (via RIP homotypic interaction motif) with RIPK3; leading to RIPK3 activation and necroptosis (PubMed:19590578, PubMed:22423968, PubMed:27746097, PubMed:27819681, PubMed:27819682, PubMed:28607035, PubMed:32200799).

Interacts (via RIP homotypic interaction motif) with RIPK1 (PubMed:19590578, PubMed:23283962).

9 Publications

(Microbial infection) Interacts (via RIP homotypic interaction motif) with murid herpesvirus protein RIR1 (via RIP homotypic interaction motif).

1 Publication

(Microbial infection) Interacts with vaccinia virus E3 protein; leading to inhibit ZBP1-dependent necroptosis.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
208387, 2 interactors

Database of interacting proteins

More...
DIPi
DIP-29879N

Protein interaction database and analysis system

More...
IntActi
Q9QY24, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000029018

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9QY24, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1411
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QY24

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9QY24

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 70Z-binding 1PROSITE-ProRule annotationAdd BLAST63
Domaini84 – 148Z-binding 2PROSITE-ProRule annotationAdd BLAST65

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi188 – 205RIP homotypic interaction motif (RHIM) 11 PublicationAdd BLAST18
Motifi237 – 261RIP homotypic interaction motif (RHIM) 21 PublicationAdd BLAST25

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Z-binding domains recognize and bind left-handed double-stranded Z-RNA structures, but not A-RNA, the right-handed double-stranded RNAs that are structurally very different from Z-RNAs (PubMed:32200799). The second Z-binding domain is essential for sensing influenza A virus (IAV) Z-RNAs (PubMed:28716805, PubMed:28607035).3 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SRWE, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002234

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1447219_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QY24

KEGG Orthology (KO)

More...
KOi
K12965

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QY24

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025735, RHIM_dom
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf
IPR042371, Zalpha_dom
IPR042361, ZBP1

The PANTHER Classification System

More...
PANTHERi
PTHR14966, PTHR14966, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12721, RHIM, 2 hits
PF02295, z-alpha, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00550, Zalpha, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785, SSF46785, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50139, Z_BINDING, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QY24-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAPVDLST GDNLEQKILQ VLSDDGGPVK IGQLVKKCQV PKKTLNQVLY
60 70 80 90 100
RLKKEDRVSS PEPATWSIGG AASGDGAPAI PENSSAQPSL DERILRFLEA
110 120 130 140 150
NGPHRALHIA KALGMTTAKE VNPLLYSMRN KHLLSYDGQT WKIYHSRQEG
160 170 180 190 200
QDIAHSGVTQ ESPAIICQHN PVNMICQQGA NSHISIANSN AIQIGHGNVI
210 220 230 240 250
VREKACGEPG PRTSHPLPLA WDASAQDMPP VAHGAQYIYM DKSLLQQVQL
260 270 280 290 300
GHHNEMSLVG DAGKHPSYSF SDSPPEVSTT TADPGASFNM QTFEPGPHPE
310 320 330 340 350
GDTVQTVHIK SCFLEDATIG NGNKMTIHLR SKGEVMESGD SEEPKKEDTG
360 370 380 390 400
TSSEATPPRS CQHTPSDSML PTSELRAMAL GDSSPQTTEP VLREHEVQDI
410
ESSQDTGLSK Q
Length:411
Mass (Da):44,331
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6D5F7B526A7DAA40
GO
Isoform 2 (identifier: Q9QY24-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-187: AHSGVTQESPAIICQHNPVNMICQQGANSHISIA → VLPCSPGCPRTHHVDQAGLEPTEIFLLLPIKFWD
     188-411: Missing.

Show »
Length:187
Mass (Da):20,569
Checksum:i216A1996CDD858DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2APF7A2APF7_MOUSE
Z-DNA-binding protein 1
Zbp1
411Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti67S → R in AAH20033 (PubMed:15489334).Curated1
Sequence conflicti83N → D in AAH20033 (PubMed:15489334).Curated1
Sequence conflicti197G → R in AAH20033 (PubMed:15489334).Curated1
Sequence conflicti293F → S in AAH20033 (PubMed:15489334).Curated1
Sequence conflicti403S → T in AAH20033 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_004083154 – 187AHSGV…HISIA → VLPCSPGCPRTHHVDQAGLE PTEIFLLLPIKFWD in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_004084188 – 411Missing in isoform 2. 1 PublicationAdd BLAST224

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF136520 mRNA Translation: AAF17234.1
AK008179 mRNA Translation: BAB25513.1
BC020033 mRNA Translation: AAH20033.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS17142.1 [Q9QY24-1]
CCDS50813.1 [Q9QY24-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001132991.1, NM_001139519.1 [Q9QY24-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000109116; ENSMUSP00000104744; ENSMUSG00000027514 [Q9QY24-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
58203

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:58203

UCSC genome browser

More...
UCSCi
uc008odp.2, mouse [Q9QY24-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF136520 mRNA Translation: AAF17234.1
AK008179 mRNA Translation: BAB25513.1
BC020033 mRNA Translation: AAH20033.1
CCDSiCCDS17142.1 [Q9QY24-1]
CCDS50813.1 [Q9QY24-2]
RefSeqiNP_001132991.1, NM_001139519.1 [Q9QY24-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1J75X-ray1.85A8-70[»]
2HEOX-ray1.70A/D8-70[»]
SMRiQ9QY24
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi208387, 2 interactors
DIPiDIP-29879N
IntActiQ9QY24, 2 interactors
STRINGi10090.ENSMUSP00000029018

PTM databases

iPTMnetiQ9QY24
PhosphoSitePlusiQ9QY24

Proteomic databases

EPDiQ9QY24
jPOSTiQ9QY24
PaxDbiQ9QY24
PRIDEiQ9QY24

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
14231, 201 antibodies

Genome annotation databases

EnsembliENSMUST00000109116; ENSMUSP00000104744; ENSMUSG00000027514 [Q9QY24-2]
GeneIDi58203
KEGGimmu:58203
UCSCiuc008odp.2, mouse [Q9QY24-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81030
MGIiMGI:1927449, Zbp1

Phylogenomic databases

eggNOGiENOG502SRWE, Eukaryota
GeneTreeiENSGT00390000002234
HOGENOMiCLU_1447219_0_0_1
InParanoidiQ9QY24
KOiK12965
PhylomeDBiQ9QY24

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
58203, 1 hit in 20 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zbp1, mouse
EvolutionaryTraceiQ9QY24

Protein Ontology

More...
PROi
PR:Q9QY24
RNActiQ9QY24, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027514, Expressed in duodenum and 123 other tissues
ExpressionAtlasiQ9QY24, baseline and differential
GenevisibleiQ9QY24, MM

Family and domain databases

Gene3Di1.10.10.10, 2 hits
InterProiView protein in InterPro
IPR025735, RHIM_dom
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf
IPR042371, Zalpha_dom
IPR042361, ZBP1
PANTHERiPTHR14966, PTHR14966, 1 hit
PfamiView protein in Pfam
PF12721, RHIM, 2 hits
PF02295, z-alpha, 2 hits
SMARTiView protein in SMART
SM00550, Zalpha, 2 hits
SUPFAMiSSF46785, SSF46785, 2 hits
PROSITEiView protein in PROSITE
PS50139, Z_BINDING, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZBP1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QY24
Secondary accession number(s): Q8VE02, Q9D8B9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: May 1, 2000
Last modified: October 7, 2020
This is version 146 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again