Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF21A

Gene

Kif21a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi88 – 95ATPPROSITE-ProRule annotation8

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189 Kinesins

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Gene namesi
Name:Kif21a
Synonyms:Kiaa1708
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:109188 Kif21a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001254631 – 1672Kinesin-like protein KIF21AAdd BLAST1672

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei258PhosphoserineCombined sources1
Modified residuei524PhosphoserineBy similarity1
Modified residuei1227PhosphoserineBy similarity1
Modified residuei1231PhosphoserineBy similarity1
Modified residuei1241PhosphoserineBy similarity1
Modified residuei1660PhosphoserineCombined sources1
Modified residuei1662PhosphothreonineBy similarity1
Modified residuei1671PhosphoserineCombined sources1
Isoform 2 (identifier: Q9QXL2-2)
Modified residuei1101PhosphoserineCombined sources1
Modified residuei1102PhosphoserineCombined sources1
Modified residuei1207PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QXL2
PeptideAtlasiQ9QXL2
PRIDEiQ9QXL2

PTM databases

iPTMnetiQ9QXL2
PhosphoSitePlusiQ9QXL2

Expressioni

Tissue specificityi

Widely expressed, with highest expression in brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000022629
CleanExiMM_KIF21A
ExpressionAtlasiQ9QXL2 baseline and differential
GenevisibleiQ9QXL2 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200939, 4 interactors
IntActiQ9QXL2, 7 interactors
MINTiQ9QXL2
STRINGi10090.ENSMUSP00000085985

Structurei

Secondary structure

11672
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1155 – 1157Combined sources3
Helixi1162 – 1166Combined sources5

3D structure databases

ProteinModelPortaliQ9QXL2
SMRiQ9QXL2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 371Kinesin motorPROSITE-ProRule annotationAdd BLAST363
Repeati1343 – 1380WD 1Add BLAST38
Repeati1383 – 1421WD 2Add BLAST39
Repeati1447 – 1485WD 3Add BLAST39
Repeati1488 – 1530WD 4Add BLAST43
Repeati1539 – 1576WD 5Add BLAST38
Repeati1580 – 1619WD 6Add BLAST40
Repeati1622 – 1659WD 7Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili365 – 840Sequence analysisAdd BLAST476
Coiled coili933 – 1021Sequence analysisAdd BLAST89
Coiled coili1055 – 1085Sequence analysisAdd BLAST31

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0244 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00910000143992
HOGENOMiHOG000280728
HOVERGENiHBG052247
InParanoidiQ9QXL2
KOiK10395
OMAiHKIRDTQ
PhylomeDBiQ9QXL2
TreeFamiTF105224

Family and domain databases

Gene3Di2.130.10.10, 2 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 3 hits
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QXL2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT
60 70 80 90 100
FDYVFDIDSQ QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT
110 120 130 140 150
GFDVNIMEEE QGIISRAVRH LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE
160 170 180 190 200
LYNEEVLDLF DTTRDIDAKN KKSNIRIHED STGGIYTVGV TTRTVNTEPE
210 220 230 240 250
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQTDAENATD
260 270 280 290 300
NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG
310 320 330 340 350
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP
360 370 380 390 400
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL
410 420 430 440 450
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR
460 470 480 490 500
ARITQLVSEQ ANQVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN
510 520 530 540 550
ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL AKKDLEKLKR
560 570 580 590 600
KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD
610 620 630 640 650
VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA
660 670 680 690 700
NITCEIAIKQ KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ
710 720 730 740 750
VLQNLGSVES YSEEKAKKVK CEYEKKLHAM NKELQRLQTA QKEHARLLKN
760 770 780 790 800
QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK EEQEKARLTE SRRNREIAQL
810 820 830 840 850
KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR PMSDKVAGKV
860 870 880 890 900
TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN
910 920 930 940 950
GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN
960 970 980 990 1000
RLLRQREELT KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY
1010 1020 1030 1040 1050
INDSIADCQA NIMQMEEAKE EGETLDVTAV INACTLTEAR YLLDHFLSMG
1060 1070 1080 1090 1100
INKGLQAAQK EAQIKVLEGR LKQTEITSAT QNQLLFHMLK EKAELNPELD
1110 1120 1130 1140 1150
ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS DLMKLCGEVK
1160 1170 1180 1190 1200
PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN
1210 1220 1230 1240 1250
TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE
1260 1270 1280 1290 1300
KADKPKAKEH KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS
1310 1320 1330 1340 1350
VQQDKSDESD SSLSEVHRGI INPFPACKGV RASPLQCVHI AEGHTKAVLC
1360 1370 1380 1390 1400
VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS LGVHPNNVVS VKYCNYTSLV
1410 1420 1430 1440 1450
FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS RTVAIPSGES
1460 1470 1480 1490 1500
QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ
1510 1520 1530 1540 1550
ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ
1560 1570 1580 1590 1600
GDNLFSGSRD NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG
1610 1620 1630 1640 1650
CRGGILKLWN VDTFVPVGEM RGHDSPINAI CVNSTHVFTA ADDRTVRIWK
1660 1670
AHNLQDGQLS DTGDLGEDIA SN
Length:1,672
Mass (Da):186,536
Last modified:July 19, 2004 - v2
Checksum:i1B2480E5129105AB
GO
Isoform 2 (identifier: Q9QXL2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1109-1115: Missing.
     1226-1305: ISRQSSLSEK...QGTPSVQQDK → M

Show »
Length:1,573
Mass (Da):175,588
Checksum:iD64D0EEBF5E9888B
GO
Isoform 3 (identifier: Q9QXL2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1227-1318: Missing.

Show »
Length:1,567
Mass (Da):174,806
Checksum:iC4AC29837E0FC17C
GO
Isoform 4 (identifier: Q9QXL2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

Show »
Length:1,616
Mass (Da):180,550
Checksum:i430FD674A10FFB34
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1127P → A in AAF17083 (PubMed:10225949).Curated1
Sequence conflicti1311S → F (PubMed:10225949).Curated1
Sequence conflicti1321I → L (PubMed:10225949).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010873558 – 570Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_0108741109 – 1115Missing in isoform 2. 1 Publication7
Alternative sequenceiVSP_0108751226 – 1305ISRQS…VQQDK → M in isoform 2. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_0108761227 – 1318Missing in isoform 3. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_0108771262 – 1318HSDSG…SEVHR → Q in isoform 4. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF202892 mRNA Translation: AAF17083.1
BC060698 mRNA Translation: AAH60698.1
BC062896 mRNA Translation: AAH62896.1
AK129426 mRNA Translation: BAC98236.1
AK049303 mRNA Translation: BAC33669.1
AK047350 mRNA Translation: BAC33031.1
CCDSiCCDS37179.1 [Q9QXL2-2]
CCDS49706.1 [Q9QXL2-3]
CCDS49708.1 [Q9QXL2-1]
RefSeqiNP_001102510.1, NM_001109040.2 [Q9QXL2-1]
NP_001102511.1, NM_001109041.2
NP_001102512.1, NM_001109042.2 [Q9QXL2-3]
NP_057914.2, NM_016705.4 [Q9QXL2-2]
UniGeneiMm.41379

Genome annotation databases

EnsembliENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629 [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629 [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629 [Q9QXL2-2]
GeneIDi16564
KEGGimmu:16564
UCSCiuc007xhs.3 mouse [Q9QXL2-1]
uc007xht.3 mouse [Q9QXL2-2]
uc007xhv.3 mouse [Q9QXL2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKI21A_MOUSE
AccessioniPrimary (citable) accession number: Q9QXL2
Secondary accession number(s): Q6P5H1
, Q6ZPJ8, Q8BWZ9, Q8BXF1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: July 18, 2018
This is version 150 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health