Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (07 Apr 2021)
Sequence version 2 (19 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Kinesin-like protein KIF21A

Gene

Kif21a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi88 – 95ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2132295, MHC class II antigen presentation
R-MMU-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189, Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF21A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kif21a
Synonyms:Kiaa1708
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:109188, Kif21a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254631 – 1672Kinesin-like protein KIF21AAdd BLAST1672

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei258PhosphoserineCombined sources1
Modified residuei524PhosphoserineBy similarity1
Modified residuei1227PhosphoserineBy similarity1
Modified residuei1231PhosphoserineBy similarity1
Modified residuei1241PhosphoserineBy similarity1
Modified residuei1660PhosphoserineCombined sources1
Modified residuei1662PhosphothreonineBy similarity1
Modified residuei1671PhosphoserineCombined sources1
Isoform 2 (identifier: Q9QXL2-2)
Modified residuei1101PhosphoserineCombined sources1
Modified residuei1102PhosphoserineCombined sources1
Modified residuei1207PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QXL2

PeptideAtlas

More...
PeptideAtlasi
Q9QXL2

PRoteomics IDEntifications database

More...
PRIDEi
Q9QXL2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
264749 [Q9QXL2-1]
264750 [Q9QXL2-2]
264751 [Q9QXL2-3]
264752 [Q9QXL2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QXL2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QXL2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with highest expression in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022629, Expressed in dorsal root ganglion and 281 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QXL2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QXL2, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
200939, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9QXL2, 7 interactors

Molecular INTeraction database

More...
MINTi
Q9QXL2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000085985

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9QXL2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11672
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QXL2

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini9 – 371Kinesin motorPROSITE-ProRule annotationAdd BLAST363
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1343 – 1380WD 1Add BLAST38
Repeati1383 – 1421WD 2Add BLAST39
Repeati1447 – 1485WD 3Add BLAST39
Repeati1488 – 1530WD 4Add BLAST43
Repeati1539 – 1576WD 5Add BLAST38
Repeati1580 – 1619WD 6Add BLAST40
Repeati1622 – 1659WD 7Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili365 – 840Sequence analysisAdd BLAST476
Coiled coili933 – 1021Sequence analysisAdd BLAST89
Coiled coili1055 – 1085Sequence analysisAdd BLAST31

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0244, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155323

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001485_4_5_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QXL2

Database of Orthologous Groups

More...
OrthoDBi
390391at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QXL2

TreeFam database of animal gene trees

More...
TreeFami
TF105224

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 2 hits
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027640, Kinesin-like_fam
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115, PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00225, Kinesin, 1 hit
PF00400, WD40, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380, KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00129, KISc, 1 hit
SM00320, WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978, SSF50978, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS00678, WD_REPEATS_1, 1 hit
PS50082, WD_REPEATS_2, 2 hits
PS50294, WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QXL2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT
60 70 80 90 100
FDYVFDIDSQ QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT
110 120 130 140 150
GFDVNIMEEE QGIISRAVRH LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE
160 170 180 190 200
LYNEEVLDLF DTTRDIDAKN KKSNIRIHED STGGIYTVGV TTRTVNTEPE
210 220 230 240 250
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQTDAENATD
260 270 280 290 300
NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG
310 320 330 340 350
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP
360 370 380 390 400
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL
410 420 430 440 450
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR
460 470 480 490 500
ARITQLVSEQ ANQVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN
510 520 530 540 550
ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL AKKDLEKLKR
560 570 580 590 600
KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD
610 620 630 640 650
VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA
660 670 680 690 700
NITCEIAIKQ KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ
710 720 730 740 750
VLQNLGSVES YSEEKAKKVK CEYEKKLHAM NKELQRLQTA QKEHARLLKN
760 770 780 790 800
QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK EEQEKARLTE SRRNREIAQL
810 820 830 840 850
KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR PMSDKVAGKV
860 870 880 890 900
TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN
910 920 930 940 950
GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN
960 970 980 990 1000
RLLRQREELT KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY
1010 1020 1030 1040 1050
INDSIADCQA NIMQMEEAKE EGETLDVTAV INACTLTEAR YLLDHFLSMG
1060 1070 1080 1090 1100
INKGLQAAQK EAQIKVLEGR LKQTEITSAT QNQLLFHMLK EKAELNPELD
1110 1120 1130 1140 1150
ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS DLMKLCGEVK
1160 1170 1180 1190 1200
PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN
1210 1220 1230 1240 1250
TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE
1260 1270 1280 1290 1300
KADKPKAKEH KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS
1310 1320 1330 1340 1350
VQQDKSDESD SSLSEVHRGI INPFPACKGV RASPLQCVHI AEGHTKAVLC
1360 1370 1380 1390 1400
VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS LGVHPNNVVS VKYCNYTSLV
1410 1420 1430 1440 1450
FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS RTVAIPSGES
1460 1470 1480 1490 1500
QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ
1510 1520 1530 1540 1550
ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ
1560 1570 1580 1590 1600
GDNLFSGSRD NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG
1610 1620 1630 1640 1650
CRGGILKLWN VDTFVPVGEM RGHDSPINAI CVNSTHVFTA ADDRTVRIWK
1660 1670
AHNLQDGQLS DTGDLGEDIA SN
Length:1,672
Mass (Da):186,536
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1B2480E5129105AB
GO
Isoform 2 (identifier: Q9QXL2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1109-1115: Missing.
     1226-1305: ISRQSSLSEK...QGTPSVQQDK → M

Show »
Length:1,573
Mass (Da):175,588
Checksum:iD64D0EEBF5E9888B
GO
Isoform 3 (identifier: Q9QXL2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1227-1318: Missing.

Show »
Length:1,567
Mass (Da):174,806
Checksum:iC4AC29837E0FC17C
GO
Isoform 4 (identifier: Q9QXL2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

Show »
Length:1,616
Mass (Da):180,550
Checksum:i430FD674A10FFB34
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q0J5E9Q0J5_MOUSE
Kinesin-like protein KIF21A
Kif21a
1,672Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WGN6F8WGN6_MOUSE
Kinesin-like protein KIF21A
Kif21a
1,628Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8VKM5A0A2R8VKM5_MOUSE
Kinesin-like protein KIF21A
Kif21a
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8VJN0A0A2R8VJN0_MOUSE
Kinesin-like protein KIF21A
Kif21a
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1127P → A in AAF17083 (PubMed:10225949).Curated1
Sequence conflicti1311S → F (PubMed:10225949).Curated1
Sequence conflicti1321I → L (PubMed:10225949).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010873558 – 570Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_0108741109 – 1115Missing in isoform 2. 1 Publication7
Alternative sequenceiVSP_0108751226 – 1305ISRQS…VQQDK → M in isoform 2. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_0108761227 – 1318Missing in isoform 3. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_0108771262 – 1318HSDSG…SEVHR → Q in isoform 4. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF202892 mRNA Translation: AAF17083.1
BC060698 mRNA Translation: AAH60698.1
BC062896 mRNA Translation: AAH62896.1
AK129426 mRNA Translation: BAC98236.1
AK049303 mRNA Translation: BAC33669.1
AK047350 mRNA Translation: BAC33031.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37179.1 [Q9QXL2-2]
CCDS49706.1 [Q9QXL2-3]
CCDS49708.1 [Q9QXL2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001102510.1, NM_001109040.2 [Q9QXL2-1]
NP_001102511.1, NM_001109041.2
NP_001102512.1, NM_001109042.2 [Q9QXL2-3]
NP_057914.2, NM_016705.4 [Q9QXL2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629 [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629 [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629 [Q9QXL2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16564

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16564

UCSC genome browser

More...
UCSCi
uc007xhs.3, mouse [Q9QXL2-1]
uc007xht.3, mouse [Q9QXL2-2]
uc007xhv.3, mouse [Q9QXL2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF202892 mRNA Translation: AAF17083.1
BC060698 mRNA Translation: AAH60698.1
BC062896 mRNA Translation: AAH62896.1
AK129426 mRNA Translation: BAC98236.1
AK049303 mRNA Translation: BAC33669.1
AK047350 mRNA Translation: BAC33031.1
CCDSiCCDS37179.1 [Q9QXL2-2]
CCDS49706.1 [Q9QXL2-3]
CCDS49708.1 [Q9QXL2-1]
RefSeqiNP_001102510.1, NM_001109040.2 [Q9QXL2-1]
NP_001102511.1, NM_001109041.2
NP_001102512.1, NM_001109042.2 [Q9QXL2-3]
NP_057914.2, NM_016705.4 [Q9QXL2-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YAYX-ray1.55B1142-1169[»]
5YBEX-ray2.11B1151-1169[»]
SMRiQ9QXL2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi200939, 7 interactors
IntActiQ9QXL2, 7 interactors
MINTiQ9QXL2
STRINGi10090.ENSMUSP00000085985

PTM databases

iPTMnetiQ9QXL2
PhosphoSitePlusiQ9QXL2

Proteomic databases

PaxDbiQ9QXL2
PeptideAtlasiQ9QXL2
PRIDEiQ9QXL2
ProteomicsDBi264749 [Q9QXL2-1]
264750 [Q9QXL2-2]
264751 [Q9QXL2-3]
264752 [Q9QXL2-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
13055, 56 antibodies

Genome annotation databases

EnsembliENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629 [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629 [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629 [Q9QXL2-2]
GeneIDi16564
KEGGimmu:16564
UCSCiuc007xhs.3, mouse [Q9QXL2-1]
uc007xht.3, mouse [Q9QXL2-2]
uc007xhv.3, mouse [Q9QXL2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55605
MGIiMGI:109188, Kif21a

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG0244, Eukaryota
GeneTreeiENSGT00940000155323
HOGENOMiCLU_001485_4_5_1
InParanoidiQ9QXL2
OrthoDBi390391at2759
PhylomeDBiQ9QXL2
TreeFamiTF105224

Enzyme and pathway databases

ReactomeiR-MMU-2132295, MHC class II antigen presentation
R-MMU-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-MMU-983189, Kinesins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
16564, 1 hit in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Kif21a, mouse

Protein Ontology

More...
PROi
PR:Q9QXL2
RNActiQ9QXL2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022629, Expressed in dorsal root ganglion and 281 other tissues
ExpressionAtlasiQ9QXL2, baseline and differential
GenevisibleiQ9QXL2, MM

Family and domain databases

Gene3Di2.130.10.10, 2 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640, Kinesin-like_fam
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf
PANTHERiPTHR24115, PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225, Kinesin, 1 hit
PF00400, WD40, 3 hits
PRINTSiPR00380, KINESINHEAVY
SMARTiView protein in SMART
SM00129, KISc, 1 hit
SM00320, WD40, 7 hits
SUPFAMiSSF50978, SSF50978, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS00678, WD_REPEATS_1, 1 hit
PS50082, WD_REPEATS_2, 2 hits
PS50294, WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKI21A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QXL2
Secondary accession number(s): Q6P5H1
, Q6ZPJ8, Q8BWZ9, Q8BXF1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: April 7, 2021
This is version 166 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again