Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9QX73 (ARHG9_RAT)

Entry version 129 (29 Sep 2021)
Sequence version 1 (01 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Rho guanine nucleotide exchange factor 9

Gene

Arhgef9

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.

3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-RNO-193648, NRAGE signals death through JNK
R-RNO-416482, G alpha (12/13) signalling events
R-RNO-9013148, CDC42 GTPase cycle
R-RNO-9013406, RHOQ GTPase cycle
R-RNO-977443, GABA receptor activation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 9
Alternative name(s):
Collybistin
Rac/Cdc42 guanine nucleotide exchange factor 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Arhgef9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Rattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...RGDi		620719, Arhgef9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasm, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi107R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. 2 Publications1
Mutagenesisi108D → A: No effect on GPHN clusters; when associated with A-107 and A-117. 2 Publications1
Mutagenesisi111R → A: Loss of formation of GPHN clusters. 2 Publications1
Mutagenesisi117E → A: No effect on GPHN clusters; when associated with A-107 and A-108. 2 Publications1
Mutagenesisi297R → H: Defects in binding to phosphatidylinositol-3-phosphate and in formation of GPHN clusters. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002538981 – 493Rho guanine nucleotide exchange factor 9Add BLAST493

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9QX73

PRoteomics IDEntifications database

More...PRIDEi		Q9QX73

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9QX73

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GPHN.

4 Publications

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1493
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9QX73

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9QX73

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 74SH3PROSITE-ProRule annotationAdd BLAST60
Domaini110 – 294DHPROSITE-ProRule annotationAdd BLAST185
Domaini325 – 432PHPROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni107 – 117Interaction with GPHNAdd BLAST11
Regioni453 – 473DisorderedSequence analysisAdd BLAST21

Keywords - Domaini

SH3 domain

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9QX73

Database of Orthologous Groups

More...OrthoDBi		428887at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9QX73

Family and domain databases

Conserved Domains Database

More...CDDi		cd00160, RhoGEF, 1 hit
cd11975, SH3_ARHGEF9, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.900.10, 1 hit
2.30.29.30, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID50103

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035728, ARHGEF9_SH3
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00169, PH, 1 hit
PF00621, RhoGEF, 1 hit
PF00018, SH3_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48065, SSF48065, 1 hit
SSF50044, SSF50044, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9QX73-1) [UniParc]FASTAAdd to basket
Also known as: Collybistin I

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK 
        60         70         80         90        100
DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL 
       110        120        130        140        150
GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE 
       160        170        180        190        200
QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI 
       210        220        230        240        250
YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV 
       260        270        280        290        300
QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN 
       310        320        330        340        350
IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF 
       360        370        380        390        400
DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK 
       410        420        430        440        450
LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR 
       460        470        480        490 
QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS
Length:493
Mass (Da):58,157
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i41040671B9398BFA
GO
Isoform 2 (identifier: Q9QX73-2) [UniParc]FASTAAdd to basket
Also known as: Collybistin II

The sequence of this isoform differs from the canonical sequence as follows:
     12-71: Missing.
     464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY

Show »
Length:411
Mass (Da):49,156
Checksum:i4AFFE36CFEE5A820
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02114712 – 71Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_021148464 – 493GRVGE…PGKKS → VTQRKWHY in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ250425 mRNA Translation: CAB65966.1
AJ302676 mRNA Translation: CAC16410.1

NCBI Reference Sequences

More...RefSeqi		NP_076447.1, NM_023957.1 [Q9QX73-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		66013

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		rno:66013

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250425 mRNA Translation: CAB65966.1
AJ302676 mRNA Translation: CAC16410.1
RefSeqiNP_076447.1, NM_023957.1 [Q9QX73-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DFKX-ray2.15A/C71-463[»]
4MT6X-ray5.50A1-456[»]
4MT7X-ray3.50A10-493[»]
SMRiQ9QX73
ModBaseiSearch...
PDBe-KBiSearch...

PTM databases

PhosphoSitePlusiQ9QX73

Proteomic databases

PaxDbiQ9QX73
PRIDEiQ9QX73

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q9QX73, 2 sequenced antibodies

Genome annotation databases

GeneIDi66013
KEGGirno:66013

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23229
RGDi620719, Arhgef9

Phylogenomic databases

InParanoidiQ9QX73
OrthoDBi428887at2759
PhylomeDBiQ9QX73

Enzyme and pathway databases

ReactomeiR-RNO-193648, NRAGE signals death through JNK
R-RNO-416482, G alpha (12/13) signalling events
R-RNO-9013148, CDC42 GTPase cycle
R-RNO-9013406, RHOQ GTPase cycle
R-RNO-977443, GABA receptor activation

Miscellaneous databases

EvolutionaryTraceiQ9QX73

Protein Ontology

More...PROi		PR:Q9QX73

Family and domain databases

CDDicd00160, RhoGEF, 1 hit
cd11975, SH3_ARHGEF9, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
IDEALiIID50103
InterProiView protein in InterPro
IPR035728, ARHGEF9_SH3
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PfamiView protein in Pfam
PF00169, PH, 1 hit
PF00621, RhoGEF, 1 hit
PF00018, SH3_1, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF48065, SSF48065, 1 hit
SSF50044, SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50002, SH3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHG9_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QX73
Secondary accession number(s): Q9ER22
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 1, 2000
Last modified: September 29, 2021
This is version 129 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again