Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA polymerase kappa

Gene

Polk

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls (PubMed:12432099). Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity (By similarity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity, Mn2+By similarityNote: Divalent metal cations. Prefers Mg2+, but can also use Mn2+.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi106MagnesiumBy similarity1
Metal bindingi197MagnesiumBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri619 – 645UBZ-type 1Add BLAST27
Zinc fingeri761 – 787UBZ-type 2Add BLAST27

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • damaged DNA binding Source: InterPro
  • DNA-directed DNA polymerase activity Source: MGI
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • cellular response to UV Source: UniProtKB
  • DNA repair Source: MGI
  • DNA replication Source: UniProtKB-KW
  • error-prone translesion synthesis Source: UniProtKB
  • nucleotide-excision repair, DNA gap filling Source: MGI
  • translesion synthesis Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, DNA-directed DNA polymerase, Mutator protein, Nucleotidyltransferase, Transferase
Biological processDNA damage, DNA repair, DNA replication, DNA synthesis
LigandMagnesium, Metal-binding, Schiff base, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5655862 Translesion synthesis by POLK
R-MMU-5656169 Termination of translesion DNA synthesis
R-MMU-5685942 HDR through Homologous Recombination (HRR)
R-MMU-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-MMU-5696400 Dual Incision in GG-NER
R-MMU-6782135 Dual incision in TC-NER
R-MMU-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA polymerase kappa (EC:2.7.7.7By similarity)
Alternative name(s):
DINB protein
Short name:
DINP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Polk
Synonyms:Dinb1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1349767 Polk

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001739911 – 852DNA polymerase kappaAdd BLAST852

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9QUG2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9QUG2

PRoteomics IDEntifications database

More...
PRIDEi
Q9QUG2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9QUG2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9QUG2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected at low levels in heart, brain, lung, liver, kidney and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021668 Expressed in 273 organ(s), highest expression level in brain blood vessel

CleanEx database of gene expression profiles

More...
CleanExi
MM_POLK

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9QUG2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9QUG2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PCNA (By similarity). Interacts with REV1 (PubMed:14657033).By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
205098, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9QUG2, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000022172

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1852
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9QUG2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9QUG2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini102 – 357UmuCAdd BLAST256

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DNA polymerase type-Y family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri619 – 645UBZ-type 1Add BLAST27
Zinc fingeri761 – 787UBZ-type 2Add BLAST27

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2094 Eukaryota
COG0389 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156667

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082711

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG101212

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9QUG2

KEGG Orthology (KO)

More...
KOi
K03511

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0679

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9QUG2

TreeFam database of animal gene trees

More...
TreeFami
TF314387

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03586 PolY_Pol_IV_kappa, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1490.100, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_01113 DNApol_IV, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036775 DNA_pol_Y-fam_lit_finger_sf
IPR017961 DNA_pol_Y-fam_little_finger
IPR022880 DNApol_IV
IPR001126 UmuC
IPR006642 Znf_Rad18_put

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00817 IMS, 1 hit
PF11799 IMS_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00734 ZnF_Rad18, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100879 SSF100879, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50173 UMUC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9QUG2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDNTKEKDNF KDDLLLRMGL NDNKAGMEGL DKEKINKIIM EATKGSRFYG
60 70 80 90 100
NELKKEKQVN QRIENMMQQK AQITSQQLRK AQLQVDKFAM ELERNRNLNN
110 120 130 140 150
TIVHVDMDAF YAAVEMRDNP ELKDKPIAVG SMSMLATSNY HARRFGVRAA
160 170 180 190 200
MPGFIAKRLC PQLIIVPPNF DKYRAVSKEV KEILAEYDPN FMAMSLDEAY
210 220 230 240 250
LNITQHLQER QDWPEDKRRY FIKMGNYLKI DTPRQEANEL TEYERSISPL
260 270 280 290 300
LFEDSPPDLQ PQGSPFQLNS EEQNNPQIAQ NSVVFGTSAE EVVKEIRFRI
310 320 330 340 350
EQKTTLTASA GIAPNTMLAK VCSDKNKPNG QYQILPSRSA VMDFIKDLPI
360 370 380 390 400
RKVSGIGKVT EKMLMALGIV TCTELYQQRA LLSLLFSETS WHYFLHIALG
410 420 430 440 450
LGSTDLARDG ERKSMSVERT FSEISKTEEQ YSLCQELCAE LAHDLQKEGL
460 470 480 490 500
KGRTVTIKLK NVNFEVKTRA STVPAAISTA EEIFAIAKEL LRTEVNVGSP
510 520 530 540 550
HPLRLRLMGV RMSTFSSEDD RKHQQRSIIG FLQAGNQALS STGDSLDKTD
560 570 580 590 600
KTELAKPLEM SHKKSFFDKK RSERISNCQD TSRCKTAGQQ ALQILEPSQA
610 620 630 640 650
LKKLSESFET SENSNDCQTF ICPVCFREQE GVSLEAFNEH VDECLDGPST
660 670 680 690 700
SENSKISCYS HASSADIGQK EDVHPSIPLC EKRGHENGEI TLVDGVDLTG
710 720 730 740 750
TEDRSLKAAR MDTLENNRSK EECPDIPDKS CPISLENETI STLSRQDSVQ
760 770 780 790 800
PCTDEVVTGR ALVCPVCNLE QETSDLTLFN IHVDICLNKG IIQELRNSEG
810 820 830 840 850
NSVKQPKESS RSTDRLQKAS GRTKRPGTKT KSSTLKKTKP RDPRHTLDGF

FK
Length:852
Mass (Da):96,003
Last modified:May 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFD8F33A6E78992F4
GO
Isoform 2 (identifier: Q9QUG2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-185: Missing.
     827-852: GTKTKSSTLKKTKPRDPRHTLDGFFK → RGATSPSAPPCLATMVPLMLPYLPVCISVSCEQMQLELAMMSMKNISLT

Note: No experimental confirmation available.
Show »
Length:739
Mass (Da):82,684
Checksum:i65B4A5A69C4F6E20
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5Q9H7Q5Q9H7_MOUSE
DNA polymerase kappa
Polk
793Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5Q9H6Q5Q9H6_MOUSE
DNA polymerase kappa
Polk
772Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5Q9H0Q5Q9H0_MOUSE
DNA polymerase kappa
Polk
467Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Y7VIV8A0A1Y7VIV8_MOUSE
DNA polymerase kappa
Polk
547Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5Q9H5Q5Q9H5_MOUSE
DNA polymerase kappa
Polk
453Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5Q9H4Q5Q9H4_MOUSE
DNA polymerase kappa
Polk
275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5Q9H3Q5Q9H3_MOUSE
DNA polymerase kappa
Polk
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Y7VJV3A0A1Y7VJV3_MOUSE
DNA polymerase kappa
Polk
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti544D → G in strain: C3H/He. 1 Publication1
Natural varianti550D → A in strain: C3H/He. 1 Publication1
Natural varianti606E → Q in strain: C3H/He. 1 Publication1
Natural varianti692L → S in strain: C3H/He. 1 Publication1
Natural varianti710R → S in strain: C3H/He. 1 Publication1
Natural varianti736E → A in strain: C3H/He. 1 Publication1
Natural varianti747D → E in strain: C3H/He. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01280750 – 185Missing in isoform 2. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_012808827 – 852GTKTK…DGFFK → RGATSPSAPPCLATMVPLML PYLPVCISVSCEQMQLELAM MSMKNISLT in isoform 2. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB027563 mRNA Translation: BAA86942.1
AF163571 mRNA Translation: AAF02541.1
AB040765 Genomic DNA Translation: BAB59059.1
BC052820 mRNA Translation: AAH52820.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS26704.1 [Q9QUG2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_036178.1, NM_012048.3 [Q9QUG2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.89926

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000022172; ENSMUSP00000022172; ENSMUSG00000021668 [Q9QUG2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27015

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:27015

UCSC genome browser

More...
UCSCi
uc007rne.1 mouse [Q9QUG2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027563 mRNA Translation: BAA86942.1
AF163571 mRNA Translation: AAF02541.1
AB040765 Genomic DNA Translation: BAB59059.1
BC052820 mRNA Translation: AAH52820.1
CCDSiCCDS26704.1 [Q9QUG2-1]
RefSeqiNP_036178.1, NM_012048.3 [Q9QUG2-1]
UniGeneiMm.89926

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LSJNMR-B560-582[»]
4FJOX-ray2.72B565-574[»]
ProteinModelPortaliQ9QUG2
SMRiQ9QUG2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi205098, 7 interactors
IntActiQ9QUG2, 1 interactor
STRINGi10090.ENSMUSP00000022172

PTM databases

iPTMnetiQ9QUG2
PhosphoSitePlusiQ9QUG2

Proteomic databases

EPDiQ9QUG2
PaxDbiQ9QUG2
PRIDEiQ9QUG2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022172; ENSMUSP00000022172; ENSMUSG00000021668 [Q9QUG2-1]
GeneIDi27015
KEGGimmu:27015
UCSCiuc007rne.1 mouse [Q9QUG2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51426
MGIiMGI:1349767 Polk

Phylogenomic databases

eggNOGiKOG2094 Eukaryota
COG0389 LUCA
GeneTreeiENSGT00940000156667
HOGENOMiHOG000082711
HOVERGENiHBG101212
InParanoidiQ9QUG2
KOiK03511
OrthoDBiEOG091G0679
PhylomeDBiQ9QUG2
TreeFamiTF314387

Enzyme and pathway databases

ReactomeiR-MMU-5655862 Translesion synthesis by POLK
R-MMU-5656169 Termination of translesion DNA synthesis
R-MMU-5685942 HDR through Homologous Recombination (HRR)
R-MMU-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-MMU-5696400 Dual Incision in GG-NER
R-MMU-6782135 Dual incision in TC-NER
R-MMU-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9QUG2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021668 Expressed in 273 organ(s), highest expression level in brain blood vessel
CleanExiMM_POLK
ExpressionAtlasiQ9QUG2 baseline and differential
GenevisibleiQ9QUG2 MM

Family and domain databases

CDDicd03586 PolY_Pol_IV_kappa, 1 hit
Gene3Di3.30.1490.100, 1 hit
HAMAPiMF_01113 DNApol_IV, 1 hit
InterProiView protein in InterPro
IPR036775 DNA_pol_Y-fam_lit_finger_sf
IPR017961 DNA_pol_Y-fam_little_finger
IPR022880 DNApol_IV
IPR001126 UmuC
IPR006642 Znf_Rad18_put
PfamiView protein in Pfam
PF00817 IMS, 1 hit
PF11799 IMS_C, 1 hit
SMARTiView protein in SMART
SM00734 ZnF_Rad18, 2 hits
SUPFAMiSSF100879 SSF100879, 1 hit
PROSITEiView protein in PROSITE
PS50173 UMUC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPOLK_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9QUG2
Secondary accession number(s): Q7TPY7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: May 1, 2000
Last modified: December 5, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again