Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 13

Gene

KLHL13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis.3 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • post-translational protein modification Source: Reactome
  • protein ubiquitination Source: UniProtKB
  • regulation of cytokinesis Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 13
Alternative name(s):
BTB and kelch domain-containing protein 2
Gene namesi
Name:KLHL13
Synonyms:BKLHD2, KIAA1309
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000003096.13
HGNCiHGNC:22931 KLHL13
MIMi300655 gene
neXtProtiNX_Q9P2N7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000003096
PharmGKBiPA134959204

Polymorphism and mutation databases

BioMutaiKLHL13
DMDMi239938883

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001191151 – 655Kelch-like protein 13Add BLAST655

Proteomic databases

MaxQBiQ9P2N7
PaxDbiQ9P2N7
PeptideAtlasiQ9P2N7
PRIDEiQ9P2N7
ProteomicsDBi83867
83868 [Q9P2N7-2]
83869 [Q9P2N7-3]
83870 [Q9P2N7-4]
83871 [Q9P2N7-5]

PTM databases

iPTMnetiQ9P2N7
PhosphoSitePlusiQ9P2N7

Expressioni

Gene expression databases

BgeeiENSG00000003096
CleanExiHS_KLHL13
ExpressionAtlasiQ9P2N7 baseline and differential
GenevisibleiQ9P2N7 HS

Organism-specific databases

HPAiHPA046039
HPA059901

Interactioni

Subunit structurei

Component of the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, at least composed of CUL3, KLHL9, KLHL13 and RBX1. Interacts with AURKB.2 Publications

Protein-protein interaction databases

BioGridi124688, 36 interactors
IntActiQ9P2N7, 25 interactors
STRINGi9606.ENSP00000443191

Structurei

3D structure databases

ProteinModelPortaliQ9P2N7
SMRiQ9P2N7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini92 – 161BTBPROSITE-ProRule annotationAdd BLAST70
Domaini196 – 297BACKAdd BLAST102
Repeati341 – 389Kelch 1Add BLAST49
Repeati390 – 441Kelch 2Add BLAST52
Repeati442 – 488Kelch 3Add BLAST47
Repeati490 – 535Kelch 4Add BLAST46
Repeati537 – 587Kelch 5Add BLAST51
Repeati588 – 636Kelch 6Add BLAST49

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441 Eukaryota
ENOG410XNX8 LUCA
GeneTreeiENSGT00760000118825
HOVERGENiHBG106526
InParanoidiQ9P2N7
KOiK10447
OMAiGIRACTM
OrthoDBiEOG091G039V
PhylomeDBiQ9P2N7
TreeFamiTF328485

Family and domain databases

Gene3Di2.120.10.80, 1 hit
InterProiView protein in InterPro
IPR011705 BACK
IPR017096 BTB-kelch_protein
IPR000210 BTB/POZ_dom
IPR015915 Kelch-typ_b-propeller
IPR006652 Kelch_1
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF01344 Kelch_1, 5 hits
PIRSFiPIRSF037037 Kelch-like_protein_gigaxonin, 1 hit
SMARTiView protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SM00612 Kelch, 6 hits
SUPFAMiSSF117281 SSF117281, 1 hit
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P2N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLKWKTSSP AIWKFPVPVL KTSRSTPLSP AYISLVEEED QHMKLSLGGS
60 70 80 90 100
EMGLSSHLQS SKAGPTRIFT SNTHSSVVLQ GFDQLRLEGL LCDVTLMPGD
110 120 130 140 150
TDDAFPVHRV MMASASDYFK AMFTGGMKEQ DLMCIKLHGV SKVGLRKIID
160 170 180 190 200
FIYTAKLSLN MDNLQDTLEA ASFLQILPVL DFCKVFLISG VTLDNCVEVG
210 220 230 240 250
RIANTYNLTE VDKYVNSFVL KNFPALLSTG EFLKLPFERL AFVLSSNSLK
260 270 280 290 300
HCTELELFKA TCRWLRLEEP RMDFAAKLMK NIRFPLMTPQ ELINYVQTVD
310 320 330 340 350
FMRTDNTCVN LLLEASNYQM MPYMQPVMQS DRTAIRSDTT HLVTLGGVLR
360 370 380 390 400
QQLVVSKELR MYDEKAHEWK SLAPMDAPRY QHGIAVIGNF LYVVGGQSNY
410 420 430 440 450
DTKGKTAVDT VFRFDPRYNK WMQVASLNEK RTFFHLSALK GYLYAVGGRN
460 470 480 490 500
AAGELPTVEC YNPRTNEWTY VAKMSEPHYG HAGTVYGGVM YISGGITHDT
510 520 530 540 550
FQKELMCFDP DTDKWIQKAP MTTVRGLHCM CTVGERLYVI GGNHFRGTSD
560 570 580 590 600
YDDVLSCEYY SPILDQWTPI AAMLRGQSDV GVAVFENKIY VVGGYSWNNR
610 620 630 640 650
CMVEIVQKYD PDKDEWHKVF DLPESLGGIR ACTLTVFPPE ETTPSPSRES

PLSAP
Length:655
Mass (Da):73,868
Last modified:June 16, 2009 - v3
Checksum:i0916420562F0B093
GO
Isoform 2 (identifier: Q9P2N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.

Show »
Length:613
Mass (Da):69,090
Checksum:iDBF234A9F50B1556
GO
Isoform 3 (identifier: Q9P2N7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MDHLHRGELVAAILRNR

Show »
Length:639
Mass (Da):72,141
Checksum:i6EEA9A2DD4455933
GO
Isoform 4 (identifier: Q9P2N7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MLRFISHLYCCSSKEDCSEDDKCILSR

Show »
Length:649
Mass (Da):73,322
Checksum:i78A8F91FDDA79734
GO
Isoform 5 (identifier: Q9P2N7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MMRVQTLREKWAYWRRRQLSLKQADFKDIFKKSTSG

Show »
Length:658
Mass (Da):74,630
Checksum:iF0CA2A42E52E6306
GO

Sequence cautioni

The sequence BAA92547 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAC41335 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14K → R in BAG54189 (PubMed:14702039).Curated1
Sequence conflicti20L → P in BAG54189 (PubMed:14702039).Curated1
Sequence conflicti352Q → R in BAG54189 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064725223F → I Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_069423261T → S1 PublicationCorresponds to variant dbSNP:rs141912385Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0375301 – 42Missing in isoform 2. 3 PublicationsAdd BLAST42
Alternative sequenceiVSP_0375311 – 33MPLKW…SPAYI → MDHLHRGELVAAILRNR in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375321 – 33MPLKW…SPAYI → MLRFISHLYCCSSKEDCSED DKCILSR in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375331 – 33MPLKW…SPAYI → MMRVQTLREKWAYWRRRQLS LKQADFKDIFKKSTSG in isoform 5. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037730 mRNA Translation: BAA92547.1 Different initiation.
AL591986 mRNA Translation: CAC41335.1 Different initiation.
AK122724 mRNA Translation: BAG53690.1
AK125356 mRNA Translation: BAG54189.1
AK296324 mRNA Translation: BAH12315.1
AK299257 mRNA Translation: BAH12978.1
AK302713 mRNA Translation: BAH13788.1
AC006968 Genomic DNA No translation available.
AC006963 Genomic DNA Translation: AAF03529.1
CH471161 Genomic DNA Translation: EAW89898.1
CH471161 Genomic DNA Translation: EAW89900.1
BC064576 mRNA Translation: AAH64576.2
CCDSiCCDS14571.1 [Q9P2N7-1]
CCDS55479.1 [Q9P2N7-2]
CCDS55480.1 [Q9P2N7-5]
CCDS55481.1 [Q9P2N7-3]
RefSeqiNP_001161771.1, NM_001168299.1 [Q9P2N7-5]
NP_001161772.1, NM_001168300.1 [Q9P2N7-4]
NP_001161773.1, NM_001168301.1 [Q9P2N7-3]
NP_001161774.1, NM_001168302.1 [Q9P2N7-3]
NP_001161775.1, NM_001168303.1 [Q9P2N7-2]
NP_277030.2, NM_033495.3 [Q9P2N7-1]
XP_011529713.1, XM_011531411.1 [Q9P2N7-1]
XP_016885439.1, XM_017029950.1 [Q9P2N7-3]
UniGeneiHs.348262

Genome annotation databases

EnsembliENST00000262820; ENSP00000262820; ENSG00000003096 [Q9P2N7-1]
ENST00000469946; ENSP00000419803; ENSG00000003096 [Q9P2N7-5]
ENST00000540167; ENSP00000441029; ENSG00000003096 [Q9P2N7-3]
ENST00000541812; ENSP00000444450; ENSG00000003096 [Q9P2N7-3]
ENST00000545703; ENSP00000440707; ENSG00000003096 [Q9P2N7-2]
GeneIDi90293
KEGGihsa:90293
UCSCiuc004eqk.4 human [Q9P2N7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKLH13_HUMAN
AccessioniPrimary (citable) accession number: Q9P2N7
Secondary accession number(s): B3KV78
, B3KWM7, B7Z3S9, B7Z5P2, B7Z802, D3DWH6, Q6P2E3, Q96QI7, Q9UDN9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: June 16, 2009
Last modified: June 20, 2018
This is version 145 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health