Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9P2K3 (RCOR3_HUMAN)

Entry version 169 (23 Feb 2022)
Sequence version 2 (07 Mar 2006)
Previous versions | rss
Add a publicationFeedback
Protein

REST corepressor 3

Gene

RCOR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a component of a corepressor complex that represses transcription.

Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9P2K3

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9P2K3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
REST corepressor 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RCOR3
Synonyms:KIAA1343
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25594, RCOR3

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9P2K3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000117625

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55758

Open Targets

More...OpenTargetsi		ENSG00000117625

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134917623

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9P2K3, Tdark

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4296112
CHEMBL4296114

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RCOR3

Domain mapping of disease mutations (DMDM)

More...DMDMi		90103520

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002267811 – 495REST corepressor 3Add BLAST495

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei156PhosphoserineCombined sources1
Modified residuei171PhosphoserineCombined sources1
Cross-linki193Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki285Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei376PhosphothreonineCombined sources1
Modified residuei445Asymmetric dimethylarginineCombined sources1
Modified residuei457Asymmetric dimethylarginineCombined sources1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9P2K3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9P2K3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9P2K3

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9P2K3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9P2K3

PeptideAtlas

More...PeptideAtlasi		Q9P2K3

PRoteomics IDEntifications database

More...PRIDEi		Q9P2K3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83829 [Q9P2K3-1]
83830 [Q9P2K3-2]
83831 [Q9P2K3-3]
83832 [Q9P2K3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9P2K3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9P2K3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000117625, Expressed in testis and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9P2K3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9P2K3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000117625, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q9P2K3
With#Exp.IntAct
CCDC102B [Q68D86]3EBI-743428,EBI-10171570
CDR2 [Q01850]3EBI-743428,EBI-1181367
CEP55 [Q53EZ4]3EBI-743428,EBI-747776
GOLGA2 [Q08379]3EBI-743428,EBI-618309
GSE1 [Q14687]9EBI-743428,EBI-372619
IKZF3 [Q9UKT9]4EBI-743428,EBI-747204
KRT15 [P19012]5EBI-743428,EBI-739566
KRT31 [Q15323]3EBI-743428,EBI-948001
KRT40 [Q6A162]3EBI-743428,EBI-10171697
LCA5 [Q86VQ0]3EBI-743428,EBI-6658186
LUZP4 [Q9P127]3EBI-743428,EBI-10198848
LZTS2 [Q9BRK4]3EBI-743428,EBI-741037
MAGEA6 [P43360]3EBI-743428,EBI-1045155
MID2 - isoform 2 [Q9UJV3-2]3EBI-743428,EBI-10172526
MIPOL1 [Q8TD10]3EBI-743428,EBI-2548751
NECAB2 - isoform 2 [Q7Z6G3-2]3EBI-743428,EBI-10172876
NINL [Q9Y2I6]4EBI-743428,EBI-719716
PRDM14 [Q9GZV8]3EBI-743428,EBI-3957793
TFIP11 [Q9UBB9]3EBI-743428,EBI-1105213
TRAF2 [Q12933]4EBI-743428,EBI-355744
TRIM27 [P14373]3EBI-743428,EBI-719493
TRIM42 [Q8IWZ5]3EBI-743428,EBI-5235829
TRIM54 [Q9BYV2]3EBI-743428,EBI-2130429
TSGA10 [Q9BZW7]3EBI-743428,EBI-744794
TXLNA [P40222]3EBI-743428,EBI-359793
Isoform 2 [Q9P2K3-2]
With#Exp.IntAct
ABI1 - isoform 5 [Q8IZP0-5]3EBI-1504830,EBI-11743294
ANKRD11 [X5D778]3EBI-1504830,EBI-17183751
BHLHB9 [Q6PI77]3EBI-1504830,EBI-11519926
BORCS6 [Q96GS4]3EBI-1504830,EBI-10193358
CBY2 - isoform 2 [Q8NA61-2]3EBI-1504830,EBI-11524851
CCDC106 [Q9BWC9]3EBI-1504830,EBI-711501
CCHCR1 - isoform 3 [Q8TD31-3]3EBI-1504830,EBI-10175300
CEP63 - isoform 3 [Q96MT8-3]3EBI-1504830,EBI-11522539
EFHC2 [Q5JST6]3EBI-1504830,EBI-2349927
FAM81A [Q8TBF8]3EBI-1504830,EBI-11993062
FGFR3 [P22607]3EBI-1504830,EBI-348399
FSD2 [A1L4K1]3EBI-1504830,EBI-5661036
GKAP1 [Q5VSY0]3EBI-1504830,EBI-743722
GLRX3 [O76003]3EBI-1504830,EBI-374781
GOLGA2 [Q08379]3EBI-1504830,EBI-618309
GRIPAP1 [Q4V328]3EBI-1504830,EBI-717919
GSE1 [Q14687]3EBI-1504830,EBI-372619
GSN [P06396]3EBI-1504830,EBI-351506
HAUS3 [Q68CZ6]3EBI-1504830,EBI-2558217
HMBOX1 [Q6NT76]3EBI-1504830,EBI-2549423
HOOK2 - isoform 2 [Q96ED9-2]3EBI-1504830,EBI-10961706
HRAS [P01112]3EBI-1504830,EBI-350145
HSF2BP [O75031]3EBI-1504830,EBI-7116203
ICA1L - isoform 2 [Q8NDH6-2]3EBI-1504830,EBI-12141931
ING5 [Q8WYH8]3EBI-1504830,EBI-488533
ISY1 - isoform 2 [Q9ULR0-1]3EBI-1504830,EBI-18398632
KDM1A [O60341]6EBI-1504830,EBI-710124
KIF1B - isoform 2 [O60333-2]3EBI-1504830,EBI-10975473
KRT15 [P19012]3EBI-1504830,EBI-739566
KRT18 [P05783]3EBI-1504830,EBI-297888
KRT19 [P08727]3EBI-1504830,EBI-742756
KRT24 [Q2M2I5]3EBI-1504830,EBI-2952736
KRT27 [Q7Z3Y8]3EBI-1504830,EBI-3044087
KRT31 [Q15323]3EBI-1504830,EBI-948001
KRT75 [O95678]3EBI-1504830,EBI-2949715
LCA5 [Q86VQ0]3EBI-1504830,EBI-6658186
LHX3 - isoform B [Q9UBR4-2]3EBI-1504830,EBI-12039345
MAGEA6 [P43360]3EBI-1504830,EBI-1045155
MCC [P23508]3EBI-1504830,EBI-307531
MESD [Q14696]3EBI-1504830,EBI-6165891
MID2 - isoform 2 [Q9UJV3-2]3EBI-1504830,EBI-10172526
MTUS2 - isoform 2 [Q5JR59-3]4EBI-1504830,EBI-11522433
NDUFB7 [P17568]3EBI-1504830,EBI-1246238
NECAB2 - isoform 2 [Q7Z6G3-2]3EBI-1504830,EBI-10172876
NEFL [P07196]3EBI-1504830,EBI-475646
NRDE2 [Q9H7Z3]3EBI-1504830,EBI-1042642
PHF19 [Q5T6S3]3EBI-1504830,EBI-2339674
PHF21B [A0A0S2Z615]3EBI-1504830,EBI-16434035
PHF21B - isoform 2 [Q96EK2-3]3EBI-1504830,EBI-16437793
PIH1D1 [Q9NWS0]3EBI-1504830,EBI-357318
PRPS1 [P60891]3EBI-1504830,EBI-749195
PTTG2 - isoform 2 [Q9NZH5-2]3EBI-1504830,EBI-17630019
SPRED1 [Q7Z699]3EBI-1504830,EBI-5235340
STN1 [Q9H668]3EBI-1504830,EBI-746930
TRAF1 [Q13077]3EBI-1504830,EBI-359224
TRIM54 [Q9BYV2]3EBI-1504830,EBI-2130429
USHBP1 [Q8N6Y0]3EBI-1504830,EBI-739895
VAX1 - isoform 2 [Q5SQQ9-2]3EBI-1504830,EBI-12227803
WFS1 [O76024]3EBI-1504830,EBI-720609
ZNF383 [Q8NA42]3EBI-1504830,EBI-20110775
ZNF688 [P0C7X2]3EBI-1504830,EBI-4395732
Q9Y6493EBI-1504830,EBI-25900580

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120876, 140 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9P2K3

Protein interaction database and analysis system

More...IntActi		Q9P2K3, 110 interactors

Molecular INTeraction database

More...MINTi		Q9P2K3

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000413929

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9P2K3

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9P2K3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1495
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9P2K3

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 83ELM2PROSITE-ProRule annotationAdd BLAST83
Domaini84 – 135SANT 1PROSITE-ProRule annotationAdd BLAST52
Domaini285 – 336SANT 2PROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni147 – 219DisorderedSequence analysisAdd BLAST73
Regioni346 – 495DisorderedSequence analysisAdd BLAST150

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili237 – 273Sequence analysisAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi166 – 184Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi346 – 373Polar residuesSequence analysisAdd BLAST28
Compositional biasi389 – 430Pro residuesSequence analysisAdd BLAST42
Compositional biasi446 – 465Pro residuesSequence analysisAdd BLAST20
Compositional biasi472 – 495Polar residuesSequence analysisAdd BLAST24

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CoREST family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1194, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154196

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_026741_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9P2K3

Identification of Orthologs from Complete Genome Data

More...OMAi		XSNQKIN

Database of Orthologous Groups

More...OrthoDBi		641792at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9P2K3

TreeFam database of animal gene trees

More...TreeFami		TF106450

Family and domain databases

Conserved Domains Database

More...CDDi		cd00167, SANT, 1 hit

Database of protein disorder

More...DisProti		DP02408 [Q9P2K3-3]

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00589

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000949, ELM2_dom
IPR009057, Homeobox-like_sf
IPR017930, Myb_dom
IPR001005, SANT/Myb
IPR017884, SANT_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01448, ELM2, 1 hit
PF00249, Myb_DNA-binding, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01189, ELM2, 1 hit
SM00717, SANT, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46689, SSF46689, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51156, ELM2, 1 hit
PS51293, SANT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P2K3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRVGAEYQAR IPEFDPGATK YTDKDNGGML VWSPYHSIPD AKLDEYIAIA 
        60         70         80         90        100
KEKHGYNVEQ ALGMLFWHKH NIEKSLADLP NFTPFPDEWT VEDKVLFEQA 
       110        120        130        140        150
FSFHGKSFHR IQQMLPDKTI ASLVKYYYSW KKTRSRTSLM DRQARKLANR 
       160        170        180        190        200
HNQGDSDDDV EETHPMDGND SDYDPKKEAK KEGNTEQPVQ TSKIGLGRRE 
       210        220        230        240        250
YQSLQHRHHS QRSKCRPPKG MYLTQEDVVA VSCSPNAANT ILRQLDMELI 
       260        270        280        290        300
SLKRQVQNAK QVNSALKQKM EGGIEEFKPP ESNQKINARW TTEEQLLAVQ 
       310        320        330        340        350
GVRKYGKDFQ AIADVIGNKT VGQVKNFFVN YRRRFNLEEV LQEWEAEQGT 
       360        370        380        390        400
QASNGDASTL GEETKSASNV PSGKSTDEEE EAQTPQAPRT LGPSPPAPSS 
       410        420        430        440        450
TPTPTAPIAT LNQPPPLLRP TLPAAPALHR QPPPLQQQAR FIQPRPTLNQ 
       460        470        480        490 
PPPPLIRPAN SMPPRLNPRP VLSTVGGQQP PSLIGIQTDS QSSLH
Length:495
Mass (Da):55,581
Last modified:March 7, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2673C9DDD3C176E4
GO
Isoform 2 (identifier: Q9P2K3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     302-378: VRKYGKDFQA...NVPSGKSTDE → TDPTGSSDTG...SASTTSYSPC
     379-495: Missing.

Show »
Length:436
Mass (Da):47,760
Checksum:i8EC674C01C49B30E
GO
Isoform 3 (identifier: Q9P2K3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM

Show »
Length:553
Mass (Da):61,214
Checksum:i9856B52333905254
GO
Isoform 4 (identifier: Q9P2K3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     382-391: AQTPQAPRTL → VCLCMEFELI
     392-495: Missing.

Show »
Length:449
Mass (Da):50,377
Checksum:i18C1B0E2688DD81A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YF22H0YF22_HUMAN
REST corepressor 3
RCOR3
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DV59B4DV59_HUMAN
REST corepressor 3
RCOR3
374Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDD7H0YDD7_HUMAN
REST corepressor 3
RCOR3
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDR8H0YDR8_HUMAN
REST corepressor 3
RCOR3
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQE5E9PQE5_HUMAN
REST corepressor 3
RCOR3
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PR63E9PR63_HUMAN
REST corepressor 3
RCOR3
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPC5E9PPC5_HUMAN
REST corepressor 3
RCOR3
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92581 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02551742K → R1 PublicationCorresponds to variant dbSNP:rs17856928Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0174601M → MPGMMEKGPELLGKNRSANG SAKSPAGGGGSGASSTNGGL HYSEPESGCSSDDEHDVGM in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_017461302 – 378VRKYG…KSTDE → TDPTGSSDTGSITSCPIIHS NTNSPYCHSEPASTTSSSNT ACCPGSSPAASSTPAAGSVH PAPANFKSASTTSYSPC in isoform 2. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_017462379 – 495Missing in isoform 2. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_041465382 – 391AQTPQAPRTL → VCLCMEFELI in isoform 4. 1 Publication10
Alternative sequenceiVSP_041466392 – 495Missing in isoform 4. 1 PublicationAdd BLAST104

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB037764 mRNA Translation: BAA92581.1 Different initiation.
AK131312 mRNA Translation: BAG54764.1
AK302664 mRNA Translation: BAG63899.1
AK001738 mRNA Translation: BAA91872.1
AL590101 Genomic DNA No translation available.
AL611964 Genomic DNA No translation available.
BC031608 mRNA Translation: AAH31608.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31016.1 [Q9P2K3-1]
CCDS44312.1 [Q9P2K3-3]
CCDS44313.1 [Q9P2K3-2]
CCDS44314.1 [Q9P2K3-4]

NCBI Reference Sequences

More...RefSeqi		NP_001129695.1, NM_001136223.1 [Q9P2K3-3]
NP_001129696.2, NM_001136224.2 [Q9P2K3-2]
NP_001129697.1, NM_001136225.1 [Q9P2K3-4]
NP_060724.1, NM_018254.3 [Q9P2K3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000367005; ENSP00000355972; ENSG00000117625
ENST00000367006; ENSP00000355973; ENSG00000117625 [Q9P2K3-2]
ENST00000419091; ENSP00000413929; ENSG00000117625 [Q9P2K3-3]
ENST00000452621; ENSP00000398558; ENSG00000117625 [Q9P2K3-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55758

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55758

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000419091.7; ENSP00000413929.2; NM_001136223.3; NP_001129695.1 [Q9P2K3-3]

UCSC genome browser

More...UCSCi		uc001hie.4, human [Q9P2K3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037764 mRNA Translation: BAA92581.1 Different initiation.
AK131312 mRNA Translation: BAG54764.1
AK302664 mRNA Translation: BAG63899.1
AK001738 mRNA Translation: BAA91872.1
AL590101 Genomic DNA No translation available.
AL611964 Genomic DNA No translation available.
BC031608 mRNA Translation: AAH31608.1
CCDSiCCDS31016.1 [Q9P2K3-1]
CCDS44312.1 [Q9P2K3-3]
CCDS44313.1 [Q9P2K3-2]
CCDS44314.1 [Q9P2K3-4]
RefSeqiNP_001129695.1, NM_001136223.1 [Q9P2K3-3]
NP_001129696.2, NM_001136224.2 [Q9P2K3-2]
NP_001129697.1, NM_001136225.1 [Q9P2K3-4]
NP_060724.1, NM_018254.3 [Q9P2K3-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4CZZX-ray3.00B1-495[»]
SMRiQ9P2K3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi120876, 140 interactors
CORUMiQ9P2K3
IntActiQ9P2K3, 110 interactors
MINTiQ9P2K3
STRINGi9606.ENSP00000413929

Chemistry databases

BindingDBiQ9P2K3
ChEMBLiCHEMBL4296112
CHEMBL4296114

PTM databases

iPTMnetiQ9P2K3
PhosphoSitePlusiQ9P2K3

Genetic variation databases

BioMutaiRCOR3
DMDMi90103520

Proteomic databases

EPDiQ9P2K3
jPOSTiQ9P2K3
MassIVEiQ9P2K3
MaxQBiQ9P2K3
PaxDbiQ9P2K3
PeptideAtlasiQ9P2K3
PRIDEiQ9P2K3
ProteomicsDBi83829 [Q9P2K3-1]
83830 [Q9P2K3-2]
83831 [Q9P2K3-3]
83832 [Q9P2K3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2380, 104 antibodies from 20 providers

The DNASU plasmid repository

More...DNASUi		55758

Genome annotation databases

EnsembliENST00000367005; ENSP00000355972; ENSG00000117625
ENST00000367006; ENSP00000355973; ENSG00000117625 [Q9P2K3-2]
ENST00000419091; ENSP00000413929; ENSG00000117625 [Q9P2K3-3]
ENST00000452621; ENSP00000398558; ENSG00000117625 [Q9P2K3-4]
GeneIDi55758
KEGGihsa:55758
MANE-SelectiENST00000419091.7; ENSP00000413929.2; NM_001136223.3; NP_001129695.1 [Q9P2K3-3]
UCSCiuc001hie.4, human [Q9P2K3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55758
DisGeNETi55758

GeneCards: human genes, protein and diseases

More...GeneCardsi		RCOR3
HGNCiHGNC:25594, RCOR3
HPAiENSG00000117625, Low tissue specificity
neXtProtiNX_Q9P2K3
OpenTargetsiENSG00000117625
PharmGKBiPA134917623
VEuPathDBiHostDB:ENSG00000117625

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1194, Eukaryota
GeneTreeiENSGT00940000154196
HOGENOMiCLU_026741_1_0_1
InParanoidiQ9P2K3
OMAiXSNQKIN
OrthoDBi641792at2759
PhylomeDBiQ9P2K3
TreeFamiTF106450

Enzyme and pathway databases

PathwayCommonsiQ9P2K3
SignaLinkiQ9P2K3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55758, 8 hits in 1070 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RCOR3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55758
PharosiQ9P2K3, Tdark

Protein Ontology

More...PROi		PR:Q9P2K3
RNActiQ9P2K3, protein

Gene expression databases

BgeeiENSG00000117625, Expressed in testis and 235 other tissues
ExpressionAtlasiQ9P2K3, baseline and differential
GenevisibleiQ9P2K3, HS

Family and domain databases

CDDicd00167, SANT, 1 hit
DisProtiDP02408 [Q9P2K3-3]
IDEALiIID00589
InterProiView protein in InterPro
IPR000949, ELM2_dom
IPR009057, Homeobox-like_sf
IPR017930, Myb_dom
IPR001005, SANT/Myb
IPR017884, SANT_dom
PfamiView protein in Pfam
PF01448, ELM2, 1 hit
PF00249, Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM01189, ELM2, 1 hit
SM00717, SANT, 2 hits
SUPFAMiSSF46689, SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS51156, ELM2, 1 hit
PS51293, SANT, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRCOR3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P2K3
Secondary accession number(s): B3KYA2
, B4DYY7, Q5VT47, Q7L9I5, Q8N5U3, Q9NV83
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: February 23, 2022
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again