Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 20

Gene

ARHGAP20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

Caution

The translocation involving this gene was originally published as t(X;11)(q13;23), but BRWD3 is localized to Xq21 and not to Xq13.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 20
Alternative name(s):
Rho-type GTPase-activating protein 20
Gene namesi
Name:ARHGAP20
Synonyms:KIAA1391
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000137727.12
HGNCiHGNC:18357 ARHGAP20
MIMi609568 gene
neXtProtiNX_Q9P2F6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving ARHGAP20 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL) (PubMed:15543602). Translocation t(X;11)(q21;q23) with BRWD3 does not result in fusion transcripts but disrupts both genes (PubMed:15543602).1 Publication

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNETi57569
OpenTargetsiENSG00000137727
PharmGKBiPA134963885

Polymorphism and mutation databases

BioMutaiARHGAP20
DMDMi143458429

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002830861 – 1191Rho GTPase-activating protein 20Add BLAST1191

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineBy similarity1
Modified residuei704PhosphoserineBy similarity1
Modified residuei730PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9P2F6
PeptideAtlasiQ9P2F6
PRIDEiQ9P2F6
ProteomicsDBi83803
83804 [Q9P2F6-2]
83805 [Q9P2F6-3]
83806 [Q9P2F6-4]

PTM databases

iPTMnetiQ9P2F6
PhosphoSitePlusiQ9P2F6

Expressioni

Tissue specificityi

Expressed predominantly in the brain. Lower expression is found in lymph nodes.1 Publication

Developmental stagei

Low expression is found in fetal liver.1 Publication

Gene expression databases

BgeeiENSG00000137727 Expressed in 170 organ(s), highest expression level in caudate nucleus
CleanExiHS_ARHGAP20
ExpressionAtlasiQ9P2F6 baseline and differential
GenevisibleiQ9P2F6 HS

Organism-specific databases

HPAiHPA038458
HPA038459
HPA076303

Interactioni

Protein-protein interaction databases

BioGridi121622, 1 interactor
IntActiQ9P2F6, 1 interactor
STRINGi9606.ENSP00000260283

Structurei

Secondary structure

11191
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9P2F6
SMRiQ9P2F6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P2F6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini78 – 180PHAdd BLAST103
Domaini194 – 295Ras-associatingPROSITE-ProRule annotationAdd BLAST102
Domaini365 – 551Rho-GAPPROSITE-ProRule annotationAdd BLAST187

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi934 – 973Ser-richAdd BLAST40

Phylogenomic databases

eggNOGiKOG4724 Eukaryota
ENOG410YV4E LUCA
GeneTreeiENSGT00530000063299
HOVERGENiHBG061748
InParanoidiQ9P2F6
KOiK20641
OMAiNICENDN
OrthoDBiEOG091G02C4
PhylomeDBiQ9P2F6
TreeFamiTF331062

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q9P2F6-1) [UniParc]FASTAAdd to basket
Also known as: 1ad

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAMSPQQET LGGQPGRSSS LTGVSRLAGG SCTKKKMKTL AERRRSAPSL
60 70 80 90 100
ILDKALQKRP TTRDSPSASV DTCTFLSSLV CSNRTLLIDG RAELKRGLQR
110 120 130 140 150
QERHLFLFND LFVVAKIKYN NNFKIKNKIK LTDMWTASCV DEVGEGNTNA
160 170 180 190 200
MKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYINLEKEK DYPKSIPLKI
210 220 230 240 250
FAKDIGNCAY SKTITVMNSD TANEVINMSL PMLGITGSER DYQLWVNSGK
260 270 280 290 300
EEAPYPLIGH EYPYGIKMSH LRDSALLTPG SKDSTTPFNL QEPFLMEQLP
310 320 330 340 350
REMQCQFILK PSRLAAAQQL SDSGHKTFKR RRSIINWAFW RGSSTHLDNL
360 370 380 390 400
PSSPTSPMPG QLFGISLPNI CENDNLPKPV LDMLFFLNQK GPLTKGIFRQ
410 420 430 440 450
SANVKSCREL KEKLNSGVEV HLDCESIFVI ASVLKDFLRN IPGSIFSSDL
460 470 480 490 500
YDHWVSVMDQ GNDEEKINTV QRLLDQLPRA NVVLLRYLFG VLHNIEQHSS
510 520 530 540 550
SNQMTAFNLA VCVAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCLRI
560 570 580 590 600
FGEEITSLFR EVSVRCDTRE NASDISCFQL NDSSYDSLEN ELNEDVDAPC
610 620 630 640 650
SDLVKKLGQG SRSMDSVLTL SDYDLDQPEV EGLLTLSDFD LAHSKDEDVQ
660 670 680 690 700
MKRPLESKPV NILVYTKIPL RDHARAPSAM CTPSYLSTAA ANAAKSLRRH
710 720 730 740 750
RRCSEPSIDY LDSKLSYLRE FYQKKLRKSS CDAILSQKDE DYLKQNQPLQ
760 770 780 790 800
EEGKTCFKQS LVTGTDVSKK NATTQNTKKK SLSGSEGNHV KLFPKSKPVA
810 820 830 840 850
ISVASYSPMS SQDHSKNQPF DVNTSGYSPP HTADALKGPR THRRCSEPNI
860 870 880 890 900
EDQNRKLTYL RGIYSKKQHK TSCEAGLLHG EEDYLKRHKS LQMEGQKLIN
910 920 930 940 950
QSLVMGIEVG KSSATNQNTE KVLPPRLNLC PRTSYSSLSS PGTSPSGSSV
960 970 980 990 1000
SSQDSAFSQI SEHSVFTPTE TSSPIDCTFQ AQRKREDLSP DFSNASHVSG
1010 1020 1030 1040 1050
MPGPSSGQAC SRPAYTKKDT MEWHSQMHSV TLHPSTWLRN GVASLKNWSL
1060 1070 1080 1090 1100
KKKAKAARPE EEKIASPKGP LEPPPHASGV PEANSLQEEQ KDLPLRAAEG
1110 1120 1130 1140 1150
LSPVQSAQRC SSSPFQDSER HCSSPFSLVE SRLKLCMKSH EEIEPGSQSS
1160 1170 1180 1190
SGSLPWERAS ASSWTLEDAT SPDSGPTVVC DIEDRYLTKD I
Length:1,191
Mass (Da):132,608
Last modified:April 3, 2007 - v2
Checksum:i1837B9DF0655AF41
GO
Isoform 2 (identifier: Q9P2F6-2) [UniParc]FASTAAdd to basket
Also known as: 1be

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTK → MTFWIIIN

Show »
Length:1,165
Mass (Da):130,235
Checksum:iDFAA6B800B24583C
GO
Isoform 3 (identifier: Q9P2F6-3) [UniParc]FASTAAdd to basket
Also known as: 1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCT → MSARERQPAL

Show »
Length:1,168
Mass (Da):130,485
Checksum:i4A148F7B05DA3586
GO
Isoform 4 (identifier: Q9P2F6-4) [UniParc]FASTAAdd to basket
Also known as: 1e, 1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:1,155
Mass (Da):128,960
Checksum:iEA4FF49422FE282E
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGG5A0A0C4DGG5_HUMAN
Rho GTPase-activating protein 20
ARHGAP20
731Annotation score:

Sequence cautioni

The sequence AAH39340 differs from that shown. Probable cloning artifact.Curated
The sequence AAH39340 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA92629 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAF84979 differs from that shown. Probable cloning artifact.Curated
The sequence BAF84979 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031489522A → T. Corresponds to variant dbSNP:rs7936020Ensembl.1
Natural variantiVAR_031490632G → D1 PublicationCorresponds to variant dbSNP:rs17853925Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0242961 – 36Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0242941 – 34MEAMS…GSCTK → MTFWIIIN in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0242951 – 33MEAMS…GGSCT → MSARERQPAL in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY496263 mRNA Translation: AAS45466.1
AY496264 mRNA Translation: AAS45467.1
AY496265 mRNA Translation: AAS45468.1
AY496266 mRNA Translation: AAS45469.1
AY496267 mRNA Translation: AAS45470.1
AB037812 mRNA Translation: BAA92629.1 Different initiation.
EF444953 Genomic DNA Translation: ACA05945.1
EF444953 Genomic DNA Translation: ACA05946.1
CH471065 Genomic DNA Translation: EAW67134.1
AK292290 mRNA Translation: BAF84979.1 Sequence problems.
BC039340 mRNA Translation: AAH39340.1 Sequence problems.
CCDSiCCDS31673.1 [Q9P2F6-1]
CCDS58175.1 [Q9P2F6-4]
CCDS58176.1 [Q9P2F6-2]
CCDS58177.1 [Q9P2F6-3]
PIRiC59436
RefSeqiNP_001245344.1, NM_001258415.1 [Q9P2F6-3]
NP_001245345.1, NM_001258416.1 [Q9P2F6-2]
NP_001245346.1, NM_001258417.1 [Q9P2F6-4]
NP_001245347.1, NM_001258418.1 [Q9P2F6-4]
NP_065860.2, NM_020809.3 [Q9P2F6-1]
XP_006718956.1, XM_006718893.3 [Q9P2F6-1]
UniGeneiHs.6136

Genome annotation databases

EnsembliENST00000260283; ENSP00000260283; ENSG00000137727 [Q9P2F6-1]
ENST00000524756; ENSP00000432076; ENSG00000137727 [Q9P2F6-3]
ENST00000527598; ENSP00000431399; ENSG00000137727 [Q9P2F6-4]
ENST00000528829; ENSP00000436319; ENSG00000137727 [Q9P2F6-4]
ENST00000533353; ENSP00000436522; ENSG00000137727 [Q9P2F6-2]
GeneIDi57569
KEGGihsa:57569
UCSCiuc001pky.3 human [Q9P2F6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY496263 mRNA Translation: AAS45466.1
AY496264 mRNA Translation: AAS45467.1
AY496265 mRNA Translation: AAS45468.1
AY496266 mRNA Translation: AAS45469.1
AY496267 mRNA Translation: AAS45470.1
AB037812 mRNA Translation: BAA92629.1 Different initiation.
EF444953 Genomic DNA Translation: ACA05945.1
EF444953 Genomic DNA Translation: ACA05946.1
CH471065 Genomic DNA Translation: EAW67134.1
AK292290 mRNA Translation: BAF84979.1 Sequence problems.
BC039340 mRNA Translation: AAH39340.1 Sequence problems.
CCDSiCCDS31673.1 [Q9P2F6-1]
CCDS58175.1 [Q9P2F6-4]
CCDS58176.1 [Q9P2F6-2]
CCDS58177.1 [Q9P2F6-3]
PIRiC59436
RefSeqiNP_001245344.1, NM_001258415.1 [Q9P2F6-3]
NP_001245345.1, NM_001258416.1 [Q9P2F6-2]
NP_001245346.1, NM_001258417.1 [Q9P2F6-4]
NP_001245347.1, NM_001258418.1 [Q9P2F6-4]
NP_065860.2, NM_020809.3 [Q9P2F6-1]
XP_006718956.1, XM_006718893.3 [Q9P2F6-1]
UniGeneiHs.6136

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MSXX-ray1.65B351-551[»]
ProteinModelPortaliQ9P2F6
SMRiQ9P2F6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121622, 1 interactor
IntActiQ9P2F6, 1 interactor
STRINGi9606.ENSP00000260283

PTM databases

iPTMnetiQ9P2F6
PhosphoSitePlusiQ9P2F6

Polymorphism and mutation databases

BioMutaiARHGAP20
DMDMi143458429

Proteomic databases

PaxDbiQ9P2F6
PeptideAtlasiQ9P2F6
PRIDEiQ9P2F6
ProteomicsDBi83803
83804 [Q9P2F6-2]
83805 [Q9P2F6-3]
83806 [Q9P2F6-4]

Protocols and materials databases

DNASUi57569
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000260283; ENSP00000260283; ENSG00000137727 [Q9P2F6-1]
ENST00000524756; ENSP00000432076; ENSG00000137727 [Q9P2F6-3]
ENST00000527598; ENSP00000431399; ENSG00000137727 [Q9P2F6-4]
ENST00000528829; ENSP00000436319; ENSG00000137727 [Q9P2F6-4]
ENST00000533353; ENSP00000436522; ENSG00000137727 [Q9P2F6-2]
GeneIDi57569
KEGGihsa:57569
UCSCiuc001pky.3 human [Q9P2F6-1]

Organism-specific databases

CTDi57569
DisGeNETi57569
EuPathDBiHostDB:ENSG00000137727.12
GeneCardsiARHGAP20
H-InvDBiHIX0010100
HGNCiHGNC:18357 ARHGAP20
HPAiHPA038458
HPA038459
HPA076303
MIMi609568 gene
neXtProtiNX_Q9P2F6
OpenTargetsiENSG00000137727
PharmGKBiPA134963885
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4724 Eukaryota
ENOG410YV4E LUCA
GeneTreeiENSGT00530000063299
HOVERGENiHBG061748
InParanoidiQ9P2F6
KOiK20641
OMAiNICENDN
OrthoDBiEOG091G02C4
PhylomeDBiQ9P2F6
TreeFamiTF331062

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Miscellaneous databases

ChiTaRSiARHGAP20 human
EvolutionaryTraceiQ9P2F6
GenomeRNAii57569
PROiPR:Q9P2F6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137727 Expressed in 170 organ(s), highest expression level in caudate nucleus
CleanExiHS_ARHGAP20
ExpressionAtlasiQ9P2F6 baseline and differential
GenevisibleiQ9P2F6 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRHG20_HUMAN
AccessioniPrimary (citable) accession number: Q9P2F6
Secondary accession number(s): A8K8C5
, B0YIW7, B0YIW8, Q6RJU1, Q6RJU2, Q6RJU3, Q6RJU5, Q8IXS1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: September 12, 2018
This is version 129 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again