Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 20

Gene

ARHGAP20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

Caution

The translocation involving this gene was originally published as t(X;11)(q13;23), but BRWD3 is localized to Xq21 and not to Xq13.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GTPase-activating protein 20
Alternative name(s):
Rho-type GTPase-activating protein 20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGAP20
Synonyms:KIAA1391
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000137727.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18357 ARHGAP20

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609568 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P2F6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving ARHGAP20 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL) (PubMed:15543602). Translocation t(X;11)(q21;q23) with BRWD3 does not result in fusion transcripts but disrupts both genes (PubMed:15543602).1 Publication

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...
DisGeNETi
57569

Open Targets

More...
OpenTargetsi
ENSG00000137727

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134963885

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGAP20

Domain mapping of disease mutations (DMDM)

More...
DMDMi
143458429

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002830861 – 1191Rho GTPase-activating protein 20Add BLAST1191

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei46PhosphoserineBy similarity1
Modified residuei704PhosphoserineBy similarity1
Modified residuei730PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P2F6

PeptideAtlas

More...
PeptideAtlasi
Q9P2F6

PRoteomics IDEntifications database

More...
PRIDEi
Q9P2F6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
83803
83804 [Q9P2F6-2]
83805 [Q9P2F6-3]
83806 [Q9P2F6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P2F6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P2F6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in the brain. Lower expression is found in lymph nodes.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Low expression is found in fetal liver.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137727 Expressed in 170 organ(s), highest expression level in caudate nucleus

CleanEx database of gene expression profiles

More...
CleanExi
HS_ARHGAP20

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9P2F6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P2F6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038458
HPA038459
HPA076303

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121622, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9P2F6, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000260283

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11191
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9P2F6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9P2F6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9P2F6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini78 – 180PHAdd BLAST103
Domaini194 – 295Ras-associatingPROSITE-ProRule annotationAdd BLAST102
Domaini365 – 551Rho-GAPPROSITE-ProRule annotationAdd BLAST187

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi934 – 973Ser-richAdd BLAST40

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4724 Eukaryota
ENOG410YV4E LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154633

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG061748

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P2F6

KEGG Orthology (KO)

More...
KOi
K20641

Identification of Orthologs from Complete Genome Data

More...
OMAi
DCESVFV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G02C4

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P2F6

TreeFam database of animal gene trees

More...
TreeFami
TF331062

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P2F6-1) [UniParc]FASTAAdd to basket
Also known as: 1ad

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAMSPQQET LGGQPGRSSS LTGVSRLAGG SCTKKKMKTL AERRRSAPSL
60 70 80 90 100
ILDKALQKRP TTRDSPSASV DTCTFLSSLV CSNRTLLIDG RAELKRGLQR
110 120 130 140 150
QERHLFLFND LFVVAKIKYN NNFKIKNKIK LTDMWTASCV DEVGEGNTNA
160 170 180 190 200
MKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYINLEKEK DYPKSIPLKI
210 220 230 240 250
FAKDIGNCAY SKTITVMNSD TANEVINMSL PMLGITGSER DYQLWVNSGK
260 270 280 290 300
EEAPYPLIGH EYPYGIKMSH LRDSALLTPG SKDSTTPFNL QEPFLMEQLP
310 320 330 340 350
REMQCQFILK PSRLAAAQQL SDSGHKTFKR RRSIINWAFW RGSSTHLDNL
360 370 380 390 400
PSSPTSPMPG QLFGISLPNI CENDNLPKPV LDMLFFLNQK GPLTKGIFRQ
410 420 430 440 450
SANVKSCREL KEKLNSGVEV HLDCESIFVI ASVLKDFLRN IPGSIFSSDL
460 470 480 490 500
YDHWVSVMDQ GNDEEKINTV QRLLDQLPRA NVVLLRYLFG VLHNIEQHSS
510 520 530 540 550
SNQMTAFNLA VCVAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCLRI
560 570 580 590 600
FGEEITSLFR EVSVRCDTRE NASDISCFQL NDSSYDSLEN ELNEDVDAPC
610 620 630 640 650
SDLVKKLGQG SRSMDSVLTL SDYDLDQPEV EGLLTLSDFD LAHSKDEDVQ
660 670 680 690 700
MKRPLESKPV NILVYTKIPL RDHARAPSAM CTPSYLSTAA ANAAKSLRRH
710 720 730 740 750
RRCSEPSIDY LDSKLSYLRE FYQKKLRKSS CDAILSQKDE DYLKQNQPLQ
760 770 780 790 800
EEGKTCFKQS LVTGTDVSKK NATTQNTKKK SLSGSEGNHV KLFPKSKPVA
810 820 830 840 850
ISVASYSPMS SQDHSKNQPF DVNTSGYSPP HTADALKGPR THRRCSEPNI
860 870 880 890 900
EDQNRKLTYL RGIYSKKQHK TSCEAGLLHG EEDYLKRHKS LQMEGQKLIN
910 920 930 940 950
QSLVMGIEVG KSSATNQNTE KVLPPRLNLC PRTSYSSLSS PGTSPSGSSV
960 970 980 990 1000
SSQDSAFSQI SEHSVFTPTE TSSPIDCTFQ AQRKREDLSP DFSNASHVSG
1010 1020 1030 1040 1050
MPGPSSGQAC SRPAYTKKDT MEWHSQMHSV TLHPSTWLRN GVASLKNWSL
1060 1070 1080 1090 1100
KKKAKAARPE EEKIASPKGP LEPPPHASGV PEANSLQEEQ KDLPLRAAEG
1110 1120 1130 1140 1150
LSPVQSAQRC SSSPFQDSER HCSSPFSLVE SRLKLCMKSH EEIEPGSQSS
1160 1170 1180 1190
SGSLPWERAS ASSWTLEDAT SPDSGPTVVC DIEDRYLTKD I
Length:1,191
Mass (Da):132,608
Last modified:April 3, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1837B9DF0655AF41
GO
Isoform 2 (identifier: Q9P2F6-2) [UniParc]FASTAAdd to basket
Also known as: 1be

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTK → MTFWIIIN

Show »
Length:1,165
Mass (Da):130,235
Checksum:iDFAA6B800B24583C
GO
Isoform 3 (identifier: Q9P2F6-3) [UniParc]FASTAAdd to basket
Also known as: 1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCT → MSARERQPAL

Show »
Length:1,168
Mass (Da):130,485
Checksum:i4A148F7B05DA3586
GO
Isoform 4 (identifier: Q9P2F6-4) [UniParc]FASTAAdd to basket
Also known as: 1e, 1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:1,155
Mass (Da):128,960
Checksum:iEA4FF49422FE282E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGG5A0A0C4DGG5_HUMAN
Rho GTPase-activating protein 20
ARHGAP20
731Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH39340 differs from that shown. Probable cloning artifact.Curated
The sequence AAH39340 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA92629 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAF84979 differs from that shown. Probable cloning artifact.Curated
The sequence BAF84979 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031489522A → T. Corresponds to variant dbSNP:rs7936020Ensembl.1
Natural variantiVAR_031490632G → D1 PublicationCorresponds to variant dbSNP:rs17853925Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0242961 – 36Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0242941 – 34MEAMS…GSCTK → MTFWIIIN in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0242951 – 33MEAMS…GGSCT → MSARERQPAL in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY496263 mRNA Translation: AAS45466.1
AY496264 mRNA Translation: AAS45467.1
AY496265 mRNA Translation: AAS45468.1
AY496266 mRNA Translation: AAS45469.1
AY496267 mRNA Translation: AAS45470.1
AB037812 mRNA Translation: BAA92629.1 Different initiation.
EF444953 Genomic DNA Translation: ACA05945.1
EF444953 Genomic DNA Translation: ACA05946.1
CH471065 Genomic DNA Translation: EAW67134.1
AK292290 mRNA Translation: BAF84979.1 Sequence problems.
BC039340 mRNA Translation: AAH39340.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31673.1 [Q9P2F6-1]
CCDS58175.1 [Q9P2F6-4]
CCDS58176.1 [Q9P2F6-2]
CCDS58177.1 [Q9P2F6-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
C59436

NCBI Reference Sequences

More...
RefSeqi
NP_001245344.1, NM_001258415.1 [Q9P2F6-3]
NP_001245345.1, NM_001258416.1 [Q9P2F6-2]
NP_001245346.1, NM_001258417.1 [Q9P2F6-4]
NP_001245347.1, NM_001258418.1 [Q9P2F6-4]
NP_065860.2, NM_020809.3 [Q9P2F6-1]
XP_006718956.1, XM_006718893.3 [Q9P2F6-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.6136

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000260283; ENSP00000260283; ENSG00000137727 [Q9P2F6-1]
ENST00000524756; ENSP00000432076; ENSG00000137727 [Q9P2F6-3]
ENST00000527598; ENSP00000431399; ENSG00000137727 [Q9P2F6-4]
ENST00000528829; ENSP00000436319; ENSG00000137727 [Q9P2F6-4]
ENST00000533353; ENSP00000436522; ENSG00000137727 [Q9P2F6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57569

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57569

UCSC genome browser

More...
UCSCi
uc001pky.3 human [Q9P2F6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY496263 mRNA Translation: AAS45466.1
AY496264 mRNA Translation: AAS45467.1
AY496265 mRNA Translation: AAS45468.1
AY496266 mRNA Translation: AAS45469.1
AY496267 mRNA Translation: AAS45470.1
AB037812 mRNA Translation: BAA92629.1 Different initiation.
EF444953 Genomic DNA Translation: ACA05945.1
EF444953 Genomic DNA Translation: ACA05946.1
CH471065 Genomic DNA Translation: EAW67134.1
AK292290 mRNA Translation: BAF84979.1 Sequence problems.
BC039340 mRNA Translation: AAH39340.1 Sequence problems.
CCDSiCCDS31673.1 [Q9P2F6-1]
CCDS58175.1 [Q9P2F6-4]
CCDS58176.1 [Q9P2F6-2]
CCDS58177.1 [Q9P2F6-3]
PIRiC59436
RefSeqiNP_001245344.1, NM_001258415.1 [Q9P2F6-3]
NP_001245345.1, NM_001258416.1 [Q9P2F6-2]
NP_001245346.1, NM_001258417.1 [Q9P2F6-4]
NP_001245347.1, NM_001258418.1 [Q9P2F6-4]
NP_065860.2, NM_020809.3 [Q9P2F6-1]
XP_006718956.1, XM_006718893.3 [Q9P2F6-1]
UniGeneiHs.6136

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MSXX-ray1.65B351-551[»]
ProteinModelPortaliQ9P2F6
SMRiQ9P2F6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121622, 1 interactor
IntActiQ9P2F6, 1 interactor
STRINGi9606.ENSP00000260283

PTM databases

iPTMnetiQ9P2F6
PhosphoSitePlusiQ9P2F6

Polymorphism and mutation databases

BioMutaiARHGAP20
DMDMi143458429

Proteomic databases

PaxDbiQ9P2F6
PeptideAtlasiQ9P2F6
PRIDEiQ9P2F6
ProteomicsDBi83803
83804 [Q9P2F6-2]
83805 [Q9P2F6-3]
83806 [Q9P2F6-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57569
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000260283; ENSP00000260283; ENSG00000137727 [Q9P2F6-1]
ENST00000524756; ENSP00000432076; ENSG00000137727 [Q9P2F6-3]
ENST00000527598; ENSP00000431399; ENSG00000137727 [Q9P2F6-4]
ENST00000528829; ENSP00000436319; ENSG00000137727 [Q9P2F6-4]
ENST00000533353; ENSP00000436522; ENSG00000137727 [Q9P2F6-2]
GeneIDi57569
KEGGihsa:57569
UCSCiuc001pky.3 human [Q9P2F6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57569
DisGeNETi57569
EuPathDBiHostDB:ENSG00000137727.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGAP20

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010100
HGNCiHGNC:18357 ARHGAP20
HPAiHPA038458
HPA038459
HPA076303
MIMi609568 gene
neXtProtiNX_Q9P2F6
OpenTargetsiENSG00000137727
PharmGKBiPA134963885

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4724 Eukaryota
ENOG410YV4E LUCA
GeneTreeiENSGT00940000154633
HOVERGENiHBG061748
InParanoidiQ9P2F6
KOiK20641
OMAiDCESVFV
OrthoDBiEOG091G02C4
PhylomeDBiQ9P2F6
TreeFamiTF331062

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARHGAP20 human
EvolutionaryTraceiQ9P2F6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57569

Protein Ontology

More...
PROi
PR:Q9P2F6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000137727 Expressed in 170 organ(s), highest expression level in caudate nucleus
CleanExiHS_ARHGAP20
ExpressionAtlasiQ9P2F6 baseline and differential
GenevisibleiQ9P2F6 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHG20_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P2F6
Secondary accession number(s): A8K8C5
, B0YIW7, B0YIW8, Q6RJU1, Q6RJU2, Q6RJU3, Q6RJU5, Q8IXS1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: December 5, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again