Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (26 Feb 2020)
Sequence version 4 (04 Nov 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Semaphorin-5B

Gene

SEMA5B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as positive axonal guidance cues.By similarity

Caution

It is uncertain whether Met-1 or Met-59 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5083635 Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214 O-glycosylation of TSR domain-containing proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Semaphorin-5B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEMA5B
Synonyms:KIAA1445, SEMAG
ORF Names:UNQ5867/PRO34001
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10737 SEMA5B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609298 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P283

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 1036ExtracellularSequence analysisAdd BLAST1036
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1037 – 1057Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini1058 – 1151CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54437

Open Targets

More...
OpenTargetsi
ENSG00000082684

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35659

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9P283 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEMA5B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
212276522

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000323371 – 1151Semaphorin-5BAdd BLAST1151

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi172 ↔ 182By similarity
Disulfide bondi199 ↔ 208By similarity
Glycosylationi236N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi322 ↔ 425By similarity
Glycosylationi345N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi346 ↔ 388By similarity
Glycosylationi436N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi556 ↔ 573By similarity
Disulfide bondi565 ↔ 582By similarity
Disulfide bondi676 ↔ 713By similarity
Disulfide bondi680 ↔ 719By similarity
Disulfide bondi691 ↔ 703By similarity
Disulfide bondi734 ↔ 765By similarity
Disulfide bondi738 ↔ 770By similarity
Disulfide bondi749 ↔ 755By similarity
Glycosylationi788O-linked (GalNAc...) threonineSequence analysis1
Disulfide bondi865 ↔ 902By similarity
Disulfide bondi869 ↔ 907By similarity
Disulfide bondi880 ↔ 892By similarity
Disulfide bondi922 ↔ 959By similarity
Disulfide bondi926 ↔ 964By similarity
Disulfide bondi937 ↔ 949By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9P283

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9P283

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9P283

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P283

PeptideAtlas

More...
PeptideAtlasi
Q9P283

PRoteomics IDEntifications database

More...
PRIDEi
Q9P283

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
30384
83748 [Q9P283-1]
83749 [Q9P283-2]
83750 [Q9P283-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P283

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P283

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000082684 Expressed in cerebral cortex and 124 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9P283 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P283 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA066548

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119953, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q9P283, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9P283

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000389588

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9P283 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 553SemaPROSITE-ProRule annotationAdd BLAST451
Domaini664 – 720TSP type-1 1PROSITE-ProRule annotationAdd BLAST57
Domaini722 – 771TSP type-1 2PROSITE-ProRule annotationAdd BLAST50
Domaini853 – 908TSP type-1 3PROSITE-ProRule annotationAdd BLAST56
Domaini910 – 965TSP type-1 4PROSITE-ProRule annotationAdd BLAST56
Domaini966 – 1010TSP type-1 5PROSITE-ProRule annotationAdd BLAST45

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the semaphorin family.Curated

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3611 Eukaryota
ENOG410XQZC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156712

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P283

KEGG Orthology (KO)

More...
KOi
K06841

Identification of Orthologs from Complete Genome Data

More...
OMAi
AICAFNM

Database of Orthologous Groups

More...
OrthoDBi
64683at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P283

TreeFam database of animal gene trees

More...
TreeFami
TF329951

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.20.100.10, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002165 Plexin_repeat
IPR016201 PSI
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR027231 Semaphorin
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11036 PTHR11036, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF00090 TSP_1, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00423 PSI, 1 hit
SM00630 Sema, 1 hit
SM00209 TSP1, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101912 SSF101912, 1 hit
SSF82895 SSF82895, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51004 SEMA, 1 hit
PS50092 TSP1, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P283-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPCGFSPSPV AHHLVPGPPD TPAQQLRCGW TVGGWLLSLV RGLLPCLPPG
60 70 80 90 100
ARTAEGPIMV LAGPLAVSLL LPSLTLLVSH LSSSQDVSSE PSSEQQLCAL
110 120 130 140 150
SKHPTVAFED LQPWVSNFTY PGARDFSQLA LDPSGNQLIV GARNYLFRLS
160 170 180 190 200
LANVSLLQAT EWASSEDTRR SCQSKGKTEE ECQNYVRVLI VAGRKVFMCG
210 220 230 240 250
TNAFSPMCTS RQVGNLSRTI EKINGVARCP YDPRHNSTAV ISSQGELYAA
260 270 280 290 300
TVIDFSGRDP AIYRSLGSGP PLRTAQYNSK WLNEPNFVAA YDIGLFAYFF
310 320 330 340 350
LRENAVEHDC GRTVYSRVAR VCKNDVGGRF LLEDTWTTFM KARLNCSRPG
360 370 380 390 400
EVPFYYNELQ SAFHLPEQDL IYGVFTTNVN SIAASAVCAF NLSAISQAFN
410 420 430 440 450
GPFRYQENPR AAWLPIANPI PNFQCGTLPE TGPNENLTER SLQDAQRLFL
460 470 480 490 500
MSEAVQPVTP EPCVTQDSVR FSHLVVDLVQ AKDTLYHVLY IGTESGTILK
510 520 530 540 550
ALSTASRSLH GCYLEELHVL PPGRREPLRS LRILHSARAL FVGLRDGVLR
560 570 580 590 600
VPLERCAAYR SQGACLGARD PYCGWDGKQQ RCSTLEDSSN MSLWTQNITA
610 620 630 640 650
CPVRNVTRDG GFGPWSPWQP CEHLDGDNSG SCLCRARSCD SPRPRCGGLD
660 670 680 690 700
CLGPAIHIAN CSRNGAWTPW SSWALCSTSC GIGFQVRQRS CSNPAPRHGG
710 720 730 740 750
RICVGKSREE RFCNENTPCP VPIFWASWGS WSKCSSNCGG GMQSRRRACE
760 770 780 790 800
NGNSCLGCGV EFKTCNPEGC PEVRRNTPWT PWLPVNVTQG GARQEQRFRF
810 820 830 840 850
TCRAPLADPH GLQFGRRRTE TRTCPADGSG SCDTDALVEV LLRSGSTSPH
860 870 880 890 900
TVSGGWAAWG PWSSCSRDCE LGFRVRKRTC TNPEPRNGGL PCVGDAAEYQ
910 920 930 940 950
DCNPQACPVR GAWSCWTSWS PCSASCGGGH YQRTRSCTSP APSPGEDICL
960 970 980 990 1000
GLHTEEALCA TQACPEGWSP WSEWSKCTDD GAQSRSRHCE ELLPGSSACA
1010 1020 1030 1040 1050
GNSSQSRPCP YSEIPVILPA SSMEEATDCA GFNLIHLVAT GISCFLGSGL
1060 1070 1080 1090 1100
LTLAVYLSCQ HCQRQSQEST LVHPATPNHL HYKGGGTPKN EKYTPMEFKT
1110 1120 1130 1140 1150
LNKNNLIPDD RANFYPLQQT NVYTTTYYPS PLNKHSFRPE ASPGQRCFPN

S
Length:1,151
Mass (Da):125,913
Last modified:November 4, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i96B1D4BC2A1E36C9
GO
Isoform 2 (identifier: Q9P283-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-760: Missing.
     966-966: Missing.
     1032-1151: FNLIHLVATG...SPGQRCFPNS → KRNRTYLMLR...ASPASWALGS

Show »
Length:1,092
Mass (Da):119,280
Checksum:i3F9AF6108E99CD23
GO
Isoform 3 (identifier: Q9P283-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     944-964: Missing.

Show »
Length:1,130
Mass (Da):123,757
Checksum:i20ECAB8D936AE0FA
GO
Isoform 4 (identifier: Q9P283-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWM

Show »
Length:1,205
Mass (Da):131,904
Checksum:i9EA9AB44CC93588D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JKR3C9JKR3_HUMAN
Semaphorin-5B
SEMA5B
1,057Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IRP9A0A3B3IRP9_HUMAN
Semaphorin-5B
SEMA5B
1,117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT43A0A3B3IT43_HUMAN
Semaphorin-5B
SEMA5B
1,092Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5ME80B5ME80_HUMAN
Semaphorin-5B
SEMA5B
1,088Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAT5F8WAT5_HUMAN
Semaphorin-5B
SEMA5B
1,094Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y5U2H0Y5U2_HUMAN
Semaphorin-5B
SEMA5B
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTV9C9JTV9_HUMAN
Semaphorin-5B
SEMA5B
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTX2C9JTX2_HUMAN
Semaphorin-5B
SEMA5B
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91570 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA95969 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti703C → F in AAQ88491 (PubMed:12975309).Curated1
Isoform 4 (identifier: Q9P283-4)
Sequence conflicti14R → K in BAH12129 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03719642G → S in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs148102705Ensembl.1
Natural variantiVAR_037197220I → T2 PublicationsCorresponds to variant dbSNP:rs2276774Ensembl.1
Natural variantiVAR_037198223I → M in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_037199742M → T1 PublicationCorresponds to variant dbSNP:rs2276781Ensembl.1
Natural variantiVAR_037200840V → D3 PublicationsCorresponds to variant dbSNP:rs2276782Ensembl.1
Natural variantiVAR_037201996S → P. Corresponds to variant dbSNP:rs35306342Ensembl.1
Natural variantiVAR_0372021028D → G3 PublicationsCorresponds to variant dbSNP:rs2303983Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0447481M → MLHLSAEEAIGCVRVRRSFI DELAFGRGHSTGTGKQKRRD RVSGSSWCLACVSWM in isoform 4. 1 Publication1
Alternative sequenceiVSP_029462760Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_029463944 – 964Missing in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_029464966Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_0294651032 – 1151FNLIH…CFPNS → KRNRTYLMLRSSQPSSTPLQ SLDSFHILLQTAKLCWGPHC FEMGSISSTWWPRASPASWA LGS in isoform 2. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB040878 mRNA Translation: BAA95969.1 Different initiation.
AY358124 mRNA Translation: AAQ88491.1
AK001234 mRNA Translation: BAA91570.1 Different initiation.
AK291407 mRNA Translation: BAF84096.1
AK295619 mRNA Translation: BAH12129.1
AC078794 Genomic DNA No translation available.
AC083797 Genomic DNA No translation available.
AC109130 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79457.1
BC077726 mRNA Translation: AAH77726.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35491.1 [Q9P283-1]
CCDS58848.1 [Q9P283-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001026872.2, NM_001031702.3 [Q9P283-1]
NP_001243275.1, NM_001256346.1 [Q9P283-1]
NP_001243276.1, NM_001256347.1 [Q9P283-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000357599; ENSP00000350215; ENSG00000082684 [Q9P283-1]
ENST00000451055; ENSP00000389588; ENSG00000082684 [Q9P283-4]
ENST00000616742; ENSP00000479602; ENSG00000082684 [Q9P283-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54437

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54437

UCSC genome browser

More...
UCSCi
uc003efz.3 human [Q9P283-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040878 mRNA Translation: BAA95969.1 Different initiation.
AY358124 mRNA Translation: AAQ88491.1
AK001234 mRNA Translation: BAA91570.1 Different initiation.
AK291407 mRNA Translation: BAF84096.1
AK295619 mRNA Translation: BAH12129.1
AC078794 Genomic DNA No translation available.
AC083797 Genomic DNA No translation available.
AC109130 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79457.1
BC077726 mRNA Translation: AAH77726.1
CCDSiCCDS35491.1 [Q9P283-1]
CCDS58848.1 [Q9P283-4]
RefSeqiNP_001026872.2, NM_001031702.3 [Q9P283-1]
NP_001243275.1, NM_001256346.1 [Q9P283-1]
NP_001243276.1, NM_001256347.1 [Q9P283-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi119953, 9 interactors
IntActiQ9P283, 8 interactors
MINTiQ9P283
STRINGi9606.ENSP00000389588

PTM databases

iPTMnetiQ9P283
PhosphoSitePlusiQ9P283

Polymorphism and mutation databases

BioMutaiSEMA5B
DMDMi212276522

Proteomic databases

jPOSTiQ9P283
MassIVEiQ9P283
MaxQBiQ9P283
PaxDbiQ9P283
PeptideAtlasiQ9P283
PRIDEiQ9P283
ProteomicsDBi30384
83748 [Q9P283-1]
83749 [Q9P283-2]
83750 [Q9P283-3]

Genome annotation databases

EnsembliENST00000357599; ENSP00000350215; ENSG00000082684 [Q9P283-1]
ENST00000451055; ENSP00000389588; ENSG00000082684 [Q9P283-4]
ENST00000616742; ENSP00000479602; ENSG00000082684 [Q9P283-1]
GeneIDi54437
KEGGihsa:54437
UCSCiuc003efz.3 human [Q9P283-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54437
DisGeNETi54437

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEMA5B
HGNCiHGNC:10737 SEMA5B
HPAiHPA066548
MIMi609298 gene
neXtProtiNX_Q9P283
OpenTargetsiENSG00000082684
PharmGKBiPA35659

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3611 Eukaryota
ENOG410XQZC LUCA
GeneTreeiENSGT00940000156712
InParanoidiQ9P283
KOiK06841
OMAiAICAFNM
OrthoDBi64683at2759
PhylomeDBiQ9P283
TreeFamiTF329951

Enzyme and pathway databases

ReactomeiR-HSA-5083635 Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214 O-glycosylation of TSR domain-containing proteins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SEMA5B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54437
PharosiQ9P283 Tbio

Protein Ontology

More...
PROi
PR:Q9P283
RNActiQ9P283 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000082684 Expressed in cerebral cortex and 124 other tissues
ExpressionAtlasiQ9P283 baseline and differential
GenevisibleiQ9P283 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.20.100.10, 6 hits
InterProiView protein in InterPro
IPR002165 Plexin_repeat
IPR016201 PSI
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR027231 Semaphorin
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR11036 PTHR11036, 1 hit
PfamiView protein in Pfam
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF00090 TSP_1, 5 hits
SMARTiView protein in SMART
SM00423 PSI, 1 hit
SM00630 Sema, 1 hit
SM00209 TSP1, 5 hits
SUPFAMiSSF101912 SSF101912, 1 hit
SSF82895 SSF82895, 5 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit
PS50092 TSP1, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEM5B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P283
Secondary accession number(s): A8K5U2
, B7Z393, F8W9U8, Q6DD89, Q6UY12, Q9NW17
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: November 4, 2008
Last modified: February 26, 2020
This is version 162 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again