Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Folliculin-interacting protein 2

Gene

FNIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a co-chaperone of HSP90AA1. Inhibits the ATPase activity of HSP90AA1 leading to reduction in its chaperone activity. Facilitates the binding of client protein FLCN to HSP90AA1 (PubMed:27353360). May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions (By similarity). May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways (PubMed:18403135). May regulate phosphorylation of RPS6KB1 (PubMed:18663353).By similarity3 Publications

Miscellaneous

Elevated expression levels in histologic variants of renal tumors.

GO - Molecular functioni

  • ATPase inhibitor activity Source: UniProtKB
  • chaperone binding Source: UniProtKB

GO - Biological processi

  • intrinsic apoptotic signaling pathway in response to DNA damage Source: UniProtKB
  • negative regulation of transcription by RNA polymerase II Source: UniProtKB
  • positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
  • positive regulation of protein complex assembly Source: ParkinsonsUK-UCL
  • protein phosphorylation Source: UniProtKB
  • regulation of protein phosphorylation Source: UniProtKB

Keywordsi

Biological processDNA damage

Names & Taxonomyi

Protein namesi
Recommended name:
Folliculin-interacting protein 2
Alternative name(s):
FNIP1-like protein
O6-methylguanine-induced apoptosis 1 protein
Gene namesi
Name:FNIP2
Synonyms:FNIPL, KIAA1450, MAPO1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000052795.12
HGNCiHGNC:29280 FNIP2
MIMi612768 gene
neXtProtiNX_Q9P278

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi57600
OpenTargetsiENSG00000052795
PharmGKBiPA162388758

Polymorphism and mutation databases

BioMutaiFNIP2
DMDMi189035874

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003205531 – 1114Folliculin-interacting protein 2Add BLAST1114

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei216PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei726PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by AMPK.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P278
MaxQBiQ9P278
PaxDbiQ9P278
PeptideAtlasiQ9P278
PRIDEiQ9P278
ProteomicsDBi83745
83746 [Q9P278-2]

PTM databases

iPTMnetiQ9P278
PhosphoSitePlusiQ9P278

Expressioni

Tissue specificityi

Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas. Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue (PubMed:18403135). Higher levels detected in oncocytoma tumors than in normal kidney. Higher levels detected in renal cell carcinoma tumors than in normal kidney tissue (PubMed:27353360).3 Publications

Gene expression databases

BgeeiENSG00000052795
CleanExiHS_FNIP2
ExpressionAtlasiQ9P278 baseline and differential
GenevisibleiQ9P278 HS

Organism-specific databases

HPAiHPA042779
HPA072420

Interactioni

Subunit structurei

Homodimer and homomultimer. Heterodimer and heteromultimer with FNIP1 (PubMed:27353360, PubMed:18403135). Interacts (via C-terminus) with FLCN (via C-terminus) (PubMed:18403135, PubMed:18663353, PubMed:27353360). Phosphorylated FLCN is preferentially bound (PubMed:18663353). Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase (PubMed:18403135, PubMed:18663353). Interacts with HSP70, HSP90AA1, STIP1, PTGES3, CDC37, BRAF, GCR and CDK4 (PubMed:27353360).3 Publications

GO - Molecular functioni

  • chaperone binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121650, 14 interactors
IntActiQ9P278, 2 interactors
MINTiQ9P278
STRINGi9606.ENSP00000264433

Structurei

3D structure databases

ProteinModelPortaliQ9P278
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini42 – 460uDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST419
Domaini468 – 1040cDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST573
Domaini1050 – 1105dDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST56

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni544 – 911Interaction with PRKAA11 PublicationAdd BLAST368

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi95 – 116Ser-richAdd BLAST22
Compositional biasi242 – 265Ser-richAdd BLAST24

Sequence similaritiesi

Belongs to the FNIP family.Curated

Phylogenomic databases

eggNOGiKOG3693 Eukaryota
ENOG410ZIEC LUCA
GeneTreeiENSGT00390000009391
HOGENOMiHOG000112624
HOVERGENiHBG059425
InParanoidiQ9P278
KOiK20401
OMAiENQLTWS
OrthoDBiEOG091G016D
PhylomeDBiQ9P278
TreeFamiTF324090

Family and domain databases

InterProiView protein in InterPro
IPR037545 DENN_FNIP1/2
IPR028086 FNIP_C_dom
IPR026156 FNIP_fam
IPR028085 FNIP_mid_dom
IPR028084 FNIP_N_dom
PANTHERiPTHR21634 PTHR21634, 1 hit
PfamiView protein in Pfam
PF14638 FNIP_C, 1 hit
PF14637 FNIP_M, 1 hit
PF14636 FNIP_N, 1 hit
PRINTSiPR02073 FOLLICULNIP1
PROSITEiView protein in PROSITE
PS51836 DENN_FNIP12, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P278-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTLLQKLF NKRGSSGSSA AASAQGRAPK EGPAFSWSCS EFDLNEIRLI
60 70 80 90 100
VYQDCDRRGR QVLFDSKAVQ KIEEVTAQKT EDVPIKISAK CCQGSSSVSS
110 120 130 140 150
SSSSSISSHS SSGGSSHHAK EQLPKYQYTR PASDVNMLGE MMFGSVAMSY
160 170 180 190 200
KGSTLKIHYI RSPPQLMISK VFSARMGSFC GSTNNLQDSF EYINQDPNLG
210 220 230 240 250
KLNTNQNSLG PCRTGSNLAH STPVDMPSRG QNEDRDSGIA RSASLSSLLI
260 270 280 290 300
TPFPSPSSST SSSSSYQRRW LRSQTTSLEN GIIPRRSTDE TFSLAEETCS
310 320 330 340 350
SNPAMVRRKK IAISIIFSLC EKEEAQRNFQ DFFFSHFPLF ESHMNRLKSA
360 370 380 390 400
IEKAMISCRK IAESSLRVQF YVSRLMEALG EFRGTIWNLY SVPRIAEPVW
410 420 430 440 450
LTMMSGTLEK NQLCQRFLKE FTLLIEQINK NQFFAALLTA VLTYHLAWVP
460 470 480 490 500
TVMPVDHPPI KAFSEKRTSQ SVNMLAKTHP YNPLWAQLGD LYGAIGSPVR
510 520 530 540 550
LTRTVVVGKQ KDLVQRILYV LTYFLRCSEL QENQLTWSGN HGEGDQVLNG
560 570 580 590 600
SKIITALEKG EVEESEYVVI TVRNEPALVP PILPPTAAER HNPWPTGFPE
610 620 630 640 650
CPEGTDSRDL GLKPDKEANR RPEQGSEACS AGCLGPASDA SWKPQNAFCG
660 670 680 690 700
DEKNKEAPQD GSSRLPSCEV LGAGMKMDQQ AVCELLKVEM PTRLPDRSVA
710 720 730 740 750
WPCPDRHLRE KPSLEKVTFQ IGSFASPESD FESRMKKMEE RVKACGPSLE
760 770 780 790 800
ASEAADVAQD PQVSRSPFKP GFQENVCCPQ NRLSEGDEGE SDKGFAEDRG
810 820 830 840 850
SRNDMAADIA GQLSHAADLG TASHGAGGTG GRRLEATRGL YVKAAEGPVL
860 870 880 890 900
EPVAPRCVQR GPGLVAGANI PCGDDNKKAN FRTEGDIPRN ESSDSALGDS
910 920 930 940 950
DDEACASAML DLGHGGDRTG GSLEVELPLP RSQSISTQNV RNFGRSLLAG
960 970 980 990 1000
YCPTYMPDLV LHGTGSDEKL KQCLVADLVH TVHHPVLDEP IAEAVCIIAD
1010 1020 1030 1040 1050
TDKWSVQVAT SQRKVTDNMK LGQDVLVSSQ VSSLLQSILQ LYKLHLPADF
1060 1070 1080 1090 1100
CIMHLEDRLQ EMYLKSKMLS EYLRGHTRVH VKELGVVLGI ESNDLPLLTA
1110
IASTHSPYVA QILL
Length:1,114
Mass (Da):122,115
Last modified:February 26, 2008 - v2
Checksum:i8951340C11EE0D5B
GO
Isoform 2 (identifier: Q9P278-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN

Show »
Length:1,137
Mass (Da):124,860
Checksum:iEE3CE381023899EC
GO

Sequence cautioni

The sequence AAH07861 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH16638 differs from that shown. Potential poly-A sequence.Curated
The sequence BAA95974 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB14338 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_045612298T → S. Corresponds to variant dbSNP:rs2276938Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0316561 – 35MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040883 mRNA Translation: BAA95974.1 Different initiation.
BC007861 mRNA Translation: AAH07861.1 Different initiation.
BC016638 mRNA Translation: AAH16638.1 Sequence problems.
AK022968 mRNA Translation: BAB14338.1 Different initiation.
CCDSiCCDS47155.1 [Q9P278-1]
RefSeqiNP_001310845.1, NM_001323916.1 [Q9P278-2]
NP_001332972.1, NM_001346043.1
NP_065891.1, NM_020840.2 [Q9P278-1]
UniGeneiHs.652441
Hs.731810

Genome annotation databases

EnsembliENST00000264433; ENSP00000264433; ENSG00000052795 [Q9P278-1]
GeneIDi57600
KEGGihsa:57600
UCSCiuc003iqe.5 human [Q9P278-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFNIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9P278
Secondary accession number(s): Q05DC3, Q96I31, Q9H994
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: June 20, 2018
This is version 107 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health