Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (17 Jun 2020)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Folliculin-interacting protein 2

Gene

FNIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binding partner of the GTPase-activating protein FLCN: involved in the cellular response to amino acid availability by regulating the mTORC1 signaling cascade controlling the MiT/TFE factors TFEB and TFE3 (PubMed:18663353, PubMed:31672913). In low-amino acid conditions, component of the lysosomal folliculin complex (LFC) on the membrane of lysosomes, which inhibits the GTPase-activating activity of FLCN, thereby inactivating mTORC1 and promoting nuclear translocation of TFEB and TFE3 (PubMed:31672913). Upon amino acid restimulation, disassembly of the LFC complex liberates the GTPase-activating activity of FLCN, leading to activation of mTORC1 and subsequent cytoplasmic retention of TFEB and TFE3 (PubMed:31672913). Together with FLCN, regulates autophagy: following phosphorylation by ULK1, interacts with GABARAP and promotes autophagy (PubMed:25126726). In addition to its role in mTORC1 signaling, also acts as a co-chaperone of HSP90AA1/Hsp90: inhibits the ATPase activity of HSP90AA1/Hsp90, leading to activate both kinase and non-kinase client proteins of HSP90AA1/Hsp90 (PubMed:18403135). Acts as a scaffold to load client protein FLCN onto HSP90AA1/Hsp90 (PubMed:18403135). Competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:18403135). May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions (By similarity).By similarity4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9639288 Amino acids regulate mTORC1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Folliculin-interacting protein 21 Publication
Alternative name(s):
FNIP1-like protein1 Publication
O6-methylguanine-induced apoptosis 1 protein1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FNIP21 PublicationImported
Synonyms:FNIPL1 Publication, KIAA14501 Publication, MAPO11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000052795.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29280 FNIP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612768 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P278

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Lysosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57600

Open Targets

More...
OpenTargetsi
ENSG00000052795

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162388758

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9P278 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FNIP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
189035874

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003205531 – 1114Folliculin-interacting protein 2Add BLAST1114

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei216PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei726PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by AMPK.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9P278

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9P278

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9P278

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9P278

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P278

PeptideAtlas

More...
PeptideAtlasi
Q9P278

PRoteomics IDEntifications database

More...
PRIDEi
Q9P278

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83745 [Q9P278-1]
83746 [Q9P278-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P278

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P278

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas (PubMed:18403135, PubMed:18663353, PubMed:27353360). Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue (PubMed:18403135). Higher levels detected in oncocytoma tumors than in normal kidney. Higher levels detected in renal cell carcinoma tumors than in normal kidney tissue (PubMed:27353360).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000052795 Expressed in kidney epithelium and 205 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9P278 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P278 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000052795 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and homomultimer (PubMed:18403135, PubMed:27353360). Heterodimer and heteromultimer with FNIP1 (PubMed:18403135, PubMed:27353360).

Interacts (via C-terminus) with FLCN (via C-terminus) (PubMed:18403135, PubMed:18663353, PubMed:27353360). Phosphorylated FLCN is preferentially bound (PubMed:18663353).

Component of the lysosomal folliculin complex (LFC), composed of FLCN, FNIP1 (or FNIP2), RRAGA/RagA or RRAGB/RagB GDP-bound, RRAGC/RagC or RRAGD/RagD GTP-bound, and Ragulator (PubMed:31704029, PubMed:31672913).

Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase (PubMed:18403135, PubMed:27353360).

Interacts with HSP70, HSP90AA1, STIP1, PTGES3, CDC37, BRAF, GCR and CDK4 (PubMed:27353360).

5 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121650, 15 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9P278

Protein interaction database and analysis system

More...
IntActi
Q9P278, 2 interactors

Molecular INTeraction database

More...
MINTi
Q9P278

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000264433

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9P278 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11114
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9P278

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini42 – 460uDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST419
Domaini468 – 1040cDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST573
Domaini1050 – 1105dDENN FNIP1/2-typePROSITE-ProRule annotationAdd BLAST56

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni544 – 911Interaction with PRKAA11 PublicationAdd BLAST368

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi95 – 116Ser-richAdd BLAST22
Compositional biasi242 – 265Ser-richAdd BLAST24

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FNIP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3693 Eukaryota
ENOG410ZIEC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009391

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003447_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P278

KEGG Orthology (KO)

More...
KOi
K20401

Identification of Orthologs from Complete Genome Data

More...
OMAi
GFQEPAL

Database of Orthologous Groups

More...
OrthoDBi
303571at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P278

TreeFam database of animal gene trees

More...
TreeFami
TF324090

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037545 DENN_FNIP1/2
IPR028086 FNIP_C_dom
IPR026156 FNIP_fam
IPR028085 FNIP_mid_dom
IPR028084 FNIP_N_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14638 FNIP_C, 1 hit
PF14637 FNIP_M, 1 hit
PF14636 FNIP_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR02073 FOLLICULNIP1

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51836 DENN_FNIP12, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P278-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPTLLQKLF NKRGSSGSSA AASAQGRAPK EGPAFSWSCS EFDLNEIRLI
60 70 80 90 100
VYQDCDRRGR QVLFDSKAVQ KIEEVTAQKT EDVPIKISAK CCQGSSSVSS
110 120 130 140 150
SSSSSISSHS SSGGSSHHAK EQLPKYQYTR PASDVNMLGE MMFGSVAMSY
160 170 180 190 200
KGSTLKIHYI RSPPQLMISK VFSARMGSFC GSTNNLQDSF EYINQDPNLG
210 220 230 240 250
KLNTNQNSLG PCRTGSNLAH STPVDMPSRG QNEDRDSGIA RSASLSSLLI
260 270 280 290 300
TPFPSPSSST SSSSSYQRRW LRSQTTSLEN GIIPRRSTDE TFSLAEETCS
310 320 330 340 350
SNPAMVRRKK IAISIIFSLC EKEEAQRNFQ DFFFSHFPLF ESHMNRLKSA
360 370 380 390 400
IEKAMISCRK IAESSLRVQF YVSRLMEALG EFRGTIWNLY SVPRIAEPVW
410 420 430 440 450
LTMMSGTLEK NQLCQRFLKE FTLLIEQINK NQFFAALLTA VLTYHLAWVP
460 470 480 490 500
TVMPVDHPPI KAFSEKRTSQ SVNMLAKTHP YNPLWAQLGD LYGAIGSPVR
510 520 530 540 550
LTRTVVVGKQ KDLVQRILYV LTYFLRCSEL QENQLTWSGN HGEGDQVLNG
560 570 580 590 600
SKIITALEKG EVEESEYVVI TVRNEPALVP PILPPTAAER HNPWPTGFPE
610 620 630 640 650
CPEGTDSRDL GLKPDKEANR RPEQGSEACS AGCLGPASDA SWKPQNAFCG
660 670 680 690 700
DEKNKEAPQD GSSRLPSCEV LGAGMKMDQQ AVCELLKVEM PTRLPDRSVA
710 720 730 740 750
WPCPDRHLRE KPSLEKVTFQ IGSFASPESD FESRMKKMEE RVKACGPSLE
760 770 780 790 800
ASEAADVAQD PQVSRSPFKP GFQENVCCPQ NRLSEGDEGE SDKGFAEDRG
810 820 830 840 850
SRNDMAADIA GQLSHAADLG TASHGAGGTG GRRLEATRGL YVKAAEGPVL
860 870 880 890 900
EPVAPRCVQR GPGLVAGANI PCGDDNKKAN FRTEGDIPRN ESSDSALGDS
910 920 930 940 950
DDEACASAML DLGHGGDRTG GSLEVELPLP RSQSISTQNV RNFGRSLLAG
960 970 980 990 1000
YCPTYMPDLV LHGTGSDEKL KQCLVADLVH TVHHPVLDEP IAEAVCIIAD
1010 1020 1030 1040 1050
TDKWSVQVAT SQRKVTDNMK LGQDVLVSSQ VSSLLQSILQ LYKLHLPADF
1060 1070 1080 1090 1100
CIMHLEDRLQ EMYLKSKMLS EYLRGHTRVH VKELGVVLGI ESNDLPLLTA
1110
IASTHSPYVA QILL
Length:1,114
Mass (Da):122,115
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8951340C11EE0D5B
GO
Isoform 2 (identifier: Q9P278-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN

Show »
Length:1,137
Mass (Da):124,860
Checksum:iEE3CE381023899EC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RFH5D6RFH5_HUMAN
Folliculin-interacting protein 2
FNIP2
673Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8F3H0Y8F3_HUMAN
Folliculin-interacting protein 2
FNIP2
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH07861 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAH16638 differs from that shown. Potential poly-A sequence.Curated
The sequence BAA95974 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAB14338 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_045612298T → S. Corresponds to variant dbSNP:rs2276938Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0316561 – 35MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB040883 mRNA Translation: BAA95974.1 Different initiation.
BC007861 mRNA Translation: AAH07861.1 Different initiation.
BC016638 mRNA Translation: AAH16638.1 Sequence problems.
AK022968 mRNA Translation: BAB14338.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47155.1 [Q9P278-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001310845.1, NM_001323916.1 [Q9P278-2]
NP_001332972.1, NM_001346043.1
NP_065891.1, NM_020840.2 [Q9P278-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000264433; ENSP00000264433; ENSG00000052795 [Q9P278-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57600

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57600

UCSC genome browser

More...
UCSCi
uc003iqe.5 human [Q9P278-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040883 mRNA Translation: BAA95974.1 Different initiation.
BC007861 mRNA Translation: AAH07861.1 Different initiation.
BC016638 mRNA Translation: AAH16638.1 Sequence problems.
AK022968 mRNA Translation: BAB14338.1 Different initiation.
CCDSiCCDS47155.1 [Q9P278-1]
RefSeqiNP_001310845.1, NM_001323916.1 [Q9P278-2]
NP_001332972.1, NM_001346043.1
NP_065891.1, NM_020840.2 [Q9P278-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6NZDelectron microscopy3.60I1-1114[»]
6ULGelectron microscopy3.31N1-1114[»]
SMRiQ9P278
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi121650, 15 interactors
CORUMiQ9P278
IntActiQ9P278, 2 interactors
MINTiQ9P278
STRINGi9606.ENSP00000264433

PTM databases

iPTMnetiQ9P278
PhosphoSitePlusiQ9P278

Polymorphism and mutation databases

BioMutaiFNIP2
DMDMi189035874

Proteomic databases

EPDiQ9P278
jPOSTiQ9P278
MassIVEiQ9P278
MaxQBiQ9P278
PaxDbiQ9P278
PeptideAtlasiQ9P278
PRIDEiQ9P278
ProteomicsDBi83745 [Q9P278-1]
83746 [Q9P278-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
28193 153 antibodies

The DNASU plasmid repository

More...
DNASUi
57600

Genome annotation databases

EnsembliENST00000264433; ENSP00000264433; ENSG00000052795 [Q9P278-1]
GeneIDi57600
KEGGihsa:57600
UCSCiuc003iqe.5 human [Q9P278-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57600
DisGeNETi57600
EuPathDBiHostDB:ENSG00000052795.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FNIP2
HGNCiHGNC:29280 FNIP2
HPAiENSG00000052795 Low tissue specificity
MIMi612768 gene
neXtProtiNX_Q9P278
OpenTargetsiENSG00000052795
PharmGKBiPA162388758

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3693 Eukaryota
ENOG410ZIEC LUCA
GeneTreeiENSGT00390000009391
HOGENOMiCLU_003447_0_0_1
InParanoidiQ9P278
KOiK20401
OMAiGFQEPAL
OrthoDBi303571at2759
PhylomeDBiQ9P278
TreeFamiTF324090

Enzyme and pathway databases

ReactomeiR-HSA-9639288 Amino acids regulate mTORC1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
57600 1 hit in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FNIP2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57600
PharosiQ9P278 Tbio

Protein Ontology

More...
PROi
PR:Q9P278
RNActiQ9P278 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000052795 Expressed in kidney epithelium and 205 other tissues
ExpressionAtlasiQ9P278 baseline and differential
GenevisibleiQ9P278 HS

Family and domain databases

InterProiView protein in InterPro
IPR037545 DENN_FNIP1/2
IPR028086 FNIP_C_dom
IPR026156 FNIP_fam
IPR028085 FNIP_mid_dom
IPR028084 FNIP_N_dom
PfamiView protein in Pfam
PF14638 FNIP_C, 1 hit
PF14637 FNIP_M, 1 hit
PF14636 FNIP_N, 1 hit
PRINTSiPR02073 FOLLICULNIP1
PROSITEiView protein in PROSITE
PS51836 DENN_FNIP12, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFNIP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P278
Secondary accession number(s): Q05DC3, Q96I31, Q9H994
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: June 17, 2020
This is version 123 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again