Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (08 May 2019)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein ZFAT

Gene

ZFAT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri12 – 35C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri116 – 141C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri271 – 293C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 321C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri326 – 349C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri354 – 377C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri404 – 426C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri458 – 481C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri742 – 764C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 793C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri798 – 822C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri830 – 853C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri880 – 903C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri909 – 931C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri937 – 959C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri966 – 988C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri994 – 1017C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1041 – 1064C2H2-type 19PROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein ZFAT
Alternative name(s):
Zinc finger gene in AITD susceptibility region
Zinc finger protein 406
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZFAT
Synonyms:KIAA1485, ZFAT1, ZNF406
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19899 ZFAT

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610931 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P243

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57623

MalaCards human disease database

More...
MalaCardsi
ZFAT

Open Targets

More...
OpenTargetsi
ENSG00000066827

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162409638

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZFAT

Domain mapping of disease mutations (DMDM)

More...
DMDMi
85681862

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000475661 – 1243Zinc finger protein ZFATAdd BLAST1243

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9P243

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9P243

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9P243

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P243

PeptideAtlas

More...
PeptideAtlasi
Q9P243

PRoteomics IDEntifications database

More...
PRIDEi
Q9P243

ProteomicsDB human proteome resource

More...
ProteomicsDBi
83726
83727 [Q9P243-2]
83728 [Q9P243-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P243

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P243

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes. Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000066827 Expressed in 134 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9P243 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P243 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA020989
HPA063592

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121669, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9P243, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367069

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11243
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ELMNMR-A768-797[»]
2ELNNMR-A796-826[»]
2ELONMR-A828-857[»]
2ELPNMR-A878-907[»]
2ELQNMR-A907-935[»]
2ELRNMR-A935-963[»]
2ELSNMR-A269-297[»]
2ELTNMR-A297-325[»]
2ELUNMR-A352-381[»]
2ELVNMR-A402-430[»]
2RSHNMR-A324-353[»]
2RSINMR-A297-381[»]
2RSJNMR-A269-353[»]
2RUTNMR-A269-297[»]
2RUUNMR-A297-325[»]
2RUVNMR-A323-353[»]
2RUWNMR-A352-381[»]
2RUXNMR-A402-430[»]
2RUYNMR-A768-797[»]
2RUZNMR-A796-826[»]
2RV0NMR-A828-857[»]
2RV1NMR-A878-907[»]
2RV2NMR-A907-935[»]
2RV3NMR-A935-963[»]
2RV6NMR-A269-353[»]
2RV7NMR-A297-381[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9P243

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9P243

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 35C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri116 – 141C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri271 – 293C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 321C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri326 – 349C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri354 – 377C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri404 – 426C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri458 – 481C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri742 – 764C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 793C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri798 – 822C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri830 – 853C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri880 – 903C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri909 – 931C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri937 – 959C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri966 – 988C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri994 – 1017C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1041 – 1064C2H2-type 19PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156658

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000155776

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P243

Identification of Orthologs from Complete Genome Data

More...
OMAi
YDMHVRT

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P243

TreeFam database of animal gene trees

More...
TreeFami
TF350017

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 19 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 8 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 10 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P243-1) [UniParc]FASTAAdd to basket
Also known as: ZFAT-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METRAAENTA IFMCKCCNLF SPNQSELLSH VSEKHMEEGV NVDEIIIPLR
60 70 80 90 100
PLSTPEPPNS SKTGDEFLVM KRKRGRPKGS TKKSSTEEEL AENIVSPTED
110 120 130 140 150
SPLAPEEGNS LPPSSLECSK CCRKFSNTRQ LRKHICIIVL NLGEEEGEAG
160 170 180 190 200
NESDLELEKK CKEDDREKAS KRPRSQKTEK VQKISGKEAR QLSGAKKPII
210 220 230 240 250
SVVLTAHEAI PGATKIVPVE AGPPETGATN SETTSADLVP RRGYQEYAIQ
260 270 280 290 300
QTPYEQPMKS SRLGPTQLKI FTCEYCNKVF KFKHSLQAHL RIHTNEKPYK
310 320 330 340 350
CPQCSYASAI KANLNVHLRK HTGEKFACDY CSFTCLSKGH LKVHIERVHK
360 370 380 390 400
KIKQHCRFCK KKYSDVKNLI KHIRDAHDPQ DKKVKEALDE LCLMTREGKR
410 420 430 440 450
QLLYDCHICE RKFKNELDRD RHMLVHGDKW PFACELCGHG ATKYQALELH
460 470 480 490 500
VRKHPFVYVC AVCRKKFVSS IRLRTHIKEV HGAAQEALVF TSSINQSFCL
510 520 530 540 550
LEPGGDIQQE ALGDQLQLVE EEFALQGVNA LKEEACPGDT QLEEGRKEPE
560 570 580 590 600
APGEMPAPAV HLASPQAEST ALPPCELETT VVSSSDLHSQ EVVSDDFLLK
610 620 630 640 650
NDTSSAEAHA APEKPPDMQH RSSVQTQGEV ITLLLSKAQS AGSDQESHGA
660 670 680 690 700
QSPLGEGQNM AVLSAGDPDP SRCLRSNPAE ASDLLPPVAG GGDTITHQPD
710 720 730 740 750
SCKAAPEHRS GITAFMKVLN SLQKKQMNTS LCERIRKVYG DLECEYCGKL
760 770 780 790 800
FWYQVHFDMH VRTHTREHLY YCSQCHYSSI TKNCLKRHVI QKHSNILLKC
810 820 830 840 850
PTDGCDYSTP DKYKLQAHLK VHTALDKRSY SCPVCEKSFS EDRLIKSHIK
860 870 880 890 900
TNHPEVSMST ISEVLGRRVQ LKGLIGKRAM KCPYCDFYFM KNGSDLQRHI
910 920 930 940 950
WAHEGVKPFK CSLCEYATRS KSNLKAHMNR HSTEKTHLCD MCGKKFKSKG
960 970 980 990 1000
TLKSHKLLHT ADGKQFKCTV CDYTAAQKPQ LLRHMEQHVS FKPFRCAHCH
1010 1020 1030 1040 1050
YSCNISGSLK RHYNRKHPNE EYANVGTGEL AAEVLIQQGG LKCPVCSFVY
1060 1070 1080 1090 1100
GTKWEFNRHL KNKHGLKVVE IDGDPKWETA TEAPEEPSTQ YLHITEAEED
1110 1120 1130 1140 1150
VQGTQAAVAA LQDLRYTSES GDRLDPTAVN ILQQIIELGA ETHDATALAS
1160 1170 1180 1190 1200
VVAMAPGTVT VVKQVTEEEP SSNHTVMIQE TVQQASVELA EQHHLVVSSD
1210 1220 1230 1240
DVEGIETVTV YTQGGEASEF IVYVQEAMQP VEEQAVEQPA QEL
Length:1,243
Mass (Da):139,034
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAF3E5339ED38D91C
GO
Isoform 2 (identifier: Q9P243-2) [UniParc]FASTAAdd to basket
Also known as: ZFAT-2, ZFAT-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.

Show »
Length:1,231
Mass (Da):137,698
Checksum:iC4BA114EEC3AF2A6
GO
Isoform 3 (identifier: Q9P243-3) [UniParc]FASTAAdd to basket
Also known as: TR-ZFAT

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.
     826-858: DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM → VSSKPKRQPRLPWVLIAFSSLCLYVGVSAAGQP
     859-1243: Missing.

Show »
Length:846
Mass (Da):94,437
Checksum:iDD3B6FD75DEEF958
GO
Isoform 4 (identifier: Q9P243-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-211: Missing.

Note: No experimental confirmation available.
Show »
Length:1,181
Mass (Da):132,137
Checksum:i8CC03D90ACB3DD3B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W7M8F8W7M8_HUMAN
Zinc finger protein ZFAT
ZFAT
1,156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PBN4E9PBN4_HUMAN
Zinc finger protein ZFAT
ZFAT
1,145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RH37E5RH37_HUMAN
Zinc finger protein ZFAT
ZFAT
998Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJT2E5RJT2_HUMAN
Zinc finger protein ZFAT
ZFAT
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGN2E5RGN2_HUMAN
Zinc finger protein ZFAT
ZFAT
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YC51H0YC51_HUMAN
Zinc finger protein ZFAT
ZFAT
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBJ1H0YBJ1_HUMAN
Zinc finger protein ZFAT
ZFAT
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJL9E5RJL9_HUMAN
Zinc finger protein ZFAT
ZFAT
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02484064G → R2 PublicationsCorresponds to variant dbSNP:rs17778003Ensembl.1
Natural variantiVAR_045815102P → S1 PublicationCorresponds to variant dbSNP:rs12541381Ensembl.1
Natural variantiVAR_052819672R → K. Corresponds to variant dbSNP:rs35003767Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0169591 – 12Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_045461150 – 211Missing in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_034938826 – 858DKRSY…PEVSM → VSSKPKRQPRLPWVLIAFSS LCLYVGVSAAGQP in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_034939859 – 1243Missing in isoform 3. 1 PublicationAdd BLAST385

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB167738 mRNA Translation: BAD12567.1
AB167739 mRNA Translation: BAD12568.1
AB167740 mRNA Translation: BAD12569.1
AB167741 mRNA Translation: BAD12570.1
AC015599 Genomic DNA No translation available.
AC087045 Genomic DNA No translation available.
AC135075 Genomic DNA No translation available.
BC025423 mRNA Translation: AAH25423.1
BC046180 mRNA Translation: AAH46180.1
BC101766 mRNA Translation: AAI01767.1
BC101768 mRNA Translation: AAI01769.1
BC143519 mRNA Translation: AAI43520.1
AB040918 mRNA Translation: BAA96009.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43768.2 [Q9P243-2]
CCDS47924.1 [Q9P243-1]
CCDS55276.1 [Q9P243-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001025110.2, NM_001029939.3 [Q9P243-2]
NP_001167628.1, NM_001174157.1 [Q9P243-4]
NP_001276323.1, NM_001289394.1 [Q9P243-2]
NP_065914.2, NM_020863.3 [Q9P243-1]
XP_011515505.1, XM_011517203.1 [Q9P243-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000377838; ENSP00000367069; ENSG00000066827 [Q9P243-1]
ENST00000520214; ENSP00000428483; ENSG00000066827 [Q9P243-2]
ENST00000520727; ENSP00000427831; ENSG00000066827 [Q9P243-2]
ENST00000523399; ENSP00000429091; ENSG00000066827 [Q9P243-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57623

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57623

UCSC genome browser

More...
UCSCi
uc003yun.4 human [Q9P243-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB167738 mRNA Translation: BAD12567.1
AB167739 mRNA Translation: BAD12568.1
AB167740 mRNA Translation: BAD12569.1
AB167741 mRNA Translation: BAD12570.1
AC015599 Genomic DNA No translation available.
AC087045 Genomic DNA No translation available.
AC135075 Genomic DNA No translation available.
BC025423 mRNA Translation: AAH25423.1
BC046180 mRNA Translation: AAH46180.1
BC101766 mRNA Translation: AAI01767.1
BC101768 mRNA Translation: AAI01769.1
BC143519 mRNA Translation: AAI43520.1
AB040918 mRNA Translation: BAA96009.1
CCDSiCCDS43768.2 [Q9P243-2]
CCDS47924.1 [Q9P243-1]
CCDS55276.1 [Q9P243-4]
RefSeqiNP_001025110.2, NM_001029939.3 [Q9P243-2]
NP_001167628.1, NM_001174157.1 [Q9P243-4]
NP_001276323.1, NM_001289394.1 [Q9P243-2]
NP_065914.2, NM_020863.3 [Q9P243-1]
XP_011515505.1, XM_011517203.1 [Q9P243-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ELMNMR-A768-797[»]
2ELNNMR-A796-826[»]
2ELONMR-A828-857[»]
2ELPNMR-A878-907[»]
2ELQNMR-A907-935[»]
2ELRNMR-A935-963[»]
2ELSNMR-A269-297[»]
2ELTNMR-A297-325[»]
2ELUNMR-A352-381[»]
2ELVNMR-A402-430[»]
2RSHNMR-A324-353[»]
2RSINMR-A297-381[»]
2RSJNMR-A269-353[»]
2RUTNMR-A269-297[»]
2RUUNMR-A297-325[»]
2RUVNMR-A323-353[»]
2RUWNMR-A352-381[»]
2RUXNMR-A402-430[»]
2RUYNMR-A768-797[»]
2RUZNMR-A796-826[»]
2RV0NMR-A828-857[»]
2RV1NMR-A878-907[»]
2RV2NMR-A907-935[»]
2RV3NMR-A935-963[»]
2RV6NMR-A269-353[»]
2RV7NMR-A297-381[»]
SMRiQ9P243
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121669, 3 interactors
IntActiQ9P243, 3 interactors
STRINGi9606.ENSP00000367069

PTM databases

iPTMnetiQ9P243
PhosphoSitePlusiQ9P243

Polymorphism and mutation databases

BioMutaiZFAT
DMDMi85681862

Proteomic databases

EPDiQ9P243
jPOSTiQ9P243
MaxQBiQ9P243
PaxDbiQ9P243
PeptideAtlasiQ9P243
PRIDEiQ9P243
ProteomicsDBi83726
83727 [Q9P243-2]
83728 [Q9P243-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377838; ENSP00000367069; ENSG00000066827 [Q9P243-1]
ENST00000520214; ENSP00000428483; ENSG00000066827 [Q9P243-2]
ENST00000520727; ENSP00000427831; ENSG00000066827 [Q9P243-2]
ENST00000523399; ENSP00000429091; ENSG00000066827 [Q9P243-4]
GeneIDi57623
KEGGihsa:57623
UCSCiuc003yun.4 human [Q9P243-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57623
DisGeNETi57623

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZFAT
HGNCiHGNC:19899 ZFAT
HPAiHPA020989
HPA063592
MalaCardsiZFAT
MIMi610931 gene
neXtProtiNX_Q9P243
OpenTargetsiENSG00000066827
PharmGKBiPA162409638

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000156658
HOGENOMiHOG000155776
InParanoidiQ9P243
OMAiYDMHVRT
OrthoDBi1318335at2759
PhylomeDBiQ9P243
TreeFamiTF350017

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZFAT human
EvolutionaryTraceiQ9P243

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57623

Protein Ontology

More...
PROi
PR:Q9P243

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000066827 Expressed in 134 organ(s), highest expression level in placenta
ExpressionAtlasiQ9P243 baseline and differential
GenevisibleiQ9P243 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 19 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 10 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZFAT_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P243
Secondary accession number(s): B7ZL15
, E9PER3, Q3MIM5, Q6PJ01, Q75PJ6, Q75PJ7, Q75PJ9, Q86X64
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 10, 2006
Last modified: May 8, 2019
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again