Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (12 Aug 2020)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Uncharacterized protein KIAA1522

Gene

KIAA1522

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • cell differentiation Source: GO_Central

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9P206

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA1522
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000162522.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29301, KIAA1522

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P206

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57648

Open Targets

More...
OpenTargetsi
ENSG00000162522

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671612

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9P206, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIAA1522

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160395559

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003112461 – 1035Uncharacterized protein KIAA1522Add BLAST1035
Isoform 3 (identifier: Q9P206-3)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei93PhosphoserineCombined sources1
Modified residuei138PhosphoserineCombined sources1
Modified residuei145PhosphoserineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei162PhosphothreonineCombined sources1
Modified residuei215PhosphoserineCombined sources1
Modified residuei320Asymmetric dimethylarginineBy similarity1
Modified residuei322PhosphoserineCombined sources1
Modified residuei327PhosphoserineCombined sources1
Modified residuei330PhosphoserineBy similarity1
Modified residuei338PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1
Modified residuei400PhosphoserineCombined sources1
Modified residuei404PhosphoserineBy similarity1
Modified residuei409PhosphoserineBy similarity1
Modified residuei531PhosphothreonineBy similarity1
Modified residuei545PhosphoserineCombined sources1
Modified residuei593PhosphothreonineCombined sources1
Modified residuei612PhosphoserineBy similarity1
Modified residuei669PhosphoserineCombined sources1
Modified residuei673PhosphoserineCombined sources1
Modified residuei858PhosphoserineCombined sources1
Modified residuei862PhosphoserineCombined sources1
Modified residuei868PhosphoserineCombined sources1
Modified residuei929PhosphoserineCombined sources1
Modified residuei959PhosphoserineCombined sources1
Modified residuei971PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Isoform 3 (identifier: Q9P206-3)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1 Publication1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Lipoprotein, Methylation, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9P206

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9P206

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9P206

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9P206

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P206

PeptideAtlas

More...
PeptideAtlasi
Q9P206

PRoteomics IDEntifications database

More...
PRIDEi
Q9P206

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83699 [Q9P206-1]
83700 [Q9P206-2]
83701 [Q9P206-3]
83702 [Q9P206-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P206

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P206

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162522, Expressed in prostate gland and 182 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P206, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162522, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121685, 30 interactors

Protein interaction database and analysis system

More...
IntActi
Q9P206, 21 interactors

Molecular INTeraction database

More...
MINTi
Q9P206

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000383851

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9P206, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi154 – 160Poly-Arg7
Compositional biasi319 – 431Ser-richAdd BLAST113
Compositional biasi438 – 997Pro-richAdd BLAST560

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QV6M, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182963

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1943035_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P206

Identification of Orthologs from Complete Genome Data

More...
OMAi
MVPGPIS

Database of Orthologous Groups

More...
OrthoDBi
315746at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P206

TreeFam database of animal gene trees

More...
TreeFami
TF333323

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9P206-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVVFVGRRLP ALLGLFKKKG SAKAENDKHL SVGPGQGPGS AVDEHQDNVF
60 70 80 90 100
FPSGRPPHLE ELHTQAQEGL RSLQHQEKQK LNKGGWDHGD TQSIQSSRTG
110 120 130 140 150
PDEDNISFCS QTTSYVAESS TAEDALSIRS EMIQRKGSTF RPHDSFPKSG
160 170 180 190 200
KSGRRRRERR STVLGLPQHV QKELGLRNER EAPGTPRAPG ARDAVRIPTV
210 220 230 240 250
DGRPRGTSGM GARVSLQALE AEAEAGAETE AMLQRHIDRV YRDDTFVGRS
260 270 280 290 300
TGTRAPPLTR PMSLAVPGLT GGAGPAEPLS PAMSISPQAT YLSKLIPHAV
310 320 330 340 350
LPPTVDVVAL GRCSLRTLSR CSLHSASPAS VRSLGRFSSV SSPQPRSRHP
360 370 380 390 400
SSSSDTWSHS QSSDTIVSDG STLSSKGGSE GQPESSTASN SVVPPPQGGS
410 420 430 440 450
GRGSPSGGST AEASDTLSIR SSGQLSGRSV SLRKLKRPPP PPRRTHSLHQ
460 470 480 490 500
RGLAVPDGPL GLPPKPERKQ QPQLPRPPTT GGSEGAGAAP CPPNPANSWV
510 520 530 540 550
PGLSPGGSRR PPRSPERTLS PSSGYSSQSG TPTLPPKGLA GPPASPGKAQ
560 570 580 590 600
PPKPERVTSL RSPGASVSSS LTSLCSSSSD PAPSDRSGPQ ILTPLGDRFV
610 620 630 640 650
IPPHPKVPAP FSPPPSKPRS PNPAAPALAA PAVVPGPVST TDASPQSPPT
660 670 680 690 700
PQTTLTPLQE SPVISKDQSP PPSPPPSYHP PPPPTKKPEV VVEAPSASET
710 720 730 740 750
AEEPLQDPNW PPPPPPAPEE QDLSMADFPP PEEAFFSVAS PEPAGPSGSP
760 770 780 790 800
ELVSSPAASS SSATALQIQP PGSPDPPPAP PAPAPASSAP GHVAKLPQKE
810 820 830 840 850
PVGCSKGGGP PREDVGAPLV TPSLLQMVRL RSVGAPGGAP TPALGPSAPQ
860 870 880 890 900
KPLRRALSGR ASPVPAPSSG LHAAVRLKAC SLAASEGLSS AQPNGPPEAE
910 920 930 940 950
PRPPQSPAST ASFIFSKGSR KLQLERPVSP ETQADLQRNL VAELRSISEQ
960 970 980 990 1000
RPPQAPKKSP KAPPPVARKP SVGVPPPASP SYPRAEPLTA PPTNGLPHTQ
1010 1020 1030
DRTKRELAEN GGVLQLVGPE EKMGLPGSDS QKELA
Length:1,035
Mass (Da):107,095
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCE674245F15108CE
GO
Isoform 2 (identifier: Q9P206-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR

Show »
Length:1,094
Mass (Da):113,062
Checksum:i214DF1694FAB0174
GO
Isoform 3 (identifier: Q9P206-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA

Show »
Length:1,046
Mass (Da):108,385
Checksum:iA7DE212FF521F3A9
GO
Isoform 4 (identifier: Q9P206-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-1028: Missing.

Show »
Length:143
Mass (Da):15,682
Checksum:i243512E893E0151D
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA96046 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03719057P → S. Corresponds to variant dbSNP:rs11803515Ensembl.1
Natural variantiVAR_037191114S → P. Corresponds to variant dbSNP:rs3737994Ensembl.1
Natural variantiVAR_037192232M → V. Corresponds to variant dbSNP:rs12730560Ensembl.1
Natural variantiVAR_037193310L → I. Corresponds to variant dbSNP:rs11582639Ensembl.1
Natural variantiVAR_037194770P → L. Corresponds to variant dbSNP:rs581875Ensembl.1
Natural variantiVAR_0371951021E → K. Corresponds to variant dbSNP:rs675928Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0402171 – 19MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0416341 – 19MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3. CuratedAdd BLAST19
Alternative sequenceiVSP_043215137 – 1028Missing in isoform 4. 1 PublicationAdd BLAST892

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB040955 mRNA Translation: BAA96046.1 Different initiation.
AK298965 mRNA Translation: BAG61060.1
AC114489 Genomic DNA No translation available.
AI587184 mRNA No translation available.
AL713671 mRNA Translation: CAD28477.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41298.1 [Q9P206-2]
CCDS55588.1 [Q9P206-1]
CCDS55589.1 [Q9P206-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001185901.1, NM_001198972.1 [Q9P206-1]
NP_001185902.1, NM_001198973.1 [Q9P206-4]
NP_065939.2, NM_020888.2 [Q9P206-2]
XP_006710854.1, XM_006710791.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294521; ENSP00000294521; ENSG00000162522 [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522 [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522 [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522 [Q9P206-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57648

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57648

UCSC genome browser

More...
UCSCi
uc001bvu.2, human [Q9P206-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040955 mRNA Translation: BAA96046.1 Different initiation.
AK298965 mRNA Translation: BAG61060.1
AC114489 Genomic DNA No translation available.
AI587184 mRNA No translation available.
AL713671 mRNA Translation: CAD28477.2
CCDSiCCDS41298.1 [Q9P206-2]
CCDS55588.1 [Q9P206-1]
CCDS55589.1 [Q9P206-4]
RefSeqiNP_001185901.1, NM_001198972.1 [Q9P206-1]
NP_001185902.1, NM_001198973.1 [Q9P206-4]
NP_065939.2, NM_020888.2 [Q9P206-2]
XP_006710854.1, XM_006710791.3

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi121685, 30 interactors
IntActiQ9P206, 21 interactors
MINTiQ9P206
STRINGi9606.ENSP00000383851

PTM databases

iPTMnetiQ9P206
PhosphoSitePlusiQ9P206

Polymorphism and mutation databases

BioMutaiKIAA1522
DMDMi160395559

Proteomic databases

EPDiQ9P206
jPOSTiQ9P206
MassIVEiQ9P206
MaxQBiQ9P206
PaxDbiQ9P206
PeptideAtlasiQ9P206
PRIDEiQ9P206
ProteomicsDBi83699 [Q9P206-1]
83700 [Q9P206-2]
83701 [Q9P206-3]
83702 [Q9P206-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31358, 43 antibodies

Genome annotation databases

EnsembliENST00000294521; ENSP00000294521; ENSG00000162522 [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522 [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522 [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522 [Q9P206-2]
GeneIDi57648
KEGGihsa:57648
UCSCiuc001bvu.2, human [Q9P206-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57648
DisGeNETi57648
EuPathDBiHostDB:ENSG00000162522.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIAA1522
HGNCiHGNC:29301, KIAA1522
HPAiENSG00000162522, Low tissue specificity
neXtProtiNX_Q9P206
OpenTargetsiENSG00000162522
PharmGKBiPA142671612

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QV6M, Eukaryota
GeneTreeiENSGT00950000182963
HOGENOMiCLU_1943035_0_0_1
InParanoidiQ9P206
OMAiMVPGPIS
OrthoDBi315746at2759
PhylomeDBiQ9P206
TreeFamiTF333323

Enzyme and pathway databases

PathwayCommonsiQ9P206

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
57648, 8 hits in 882 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIAA1522, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57648
PharosiQ9P206, Tdark

Protein Ontology

More...
PROi
PR:Q9P206
RNActiQ9P206, protein

Gene expression databases

BgeeiENSG00000162522, Expressed in prostate gland and 182 other tissues
GenevisibleiQ9P206, HS

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1522_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P206
Secondary accession number(s): B4DQU8
, B5MDY0, C9JH84, Q8TCQ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: August 12, 2020
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again