Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-binding and coiled-coil domain-containing protein 1

Gene

CALCOCO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions (By similarity). In association with CCAR1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).By similarity1 Publication
Seems to enhance inorganic pyrphosphatase thus activating phosphogluomutase (PMG). Probably functions as component of the calphoglin complex, which is involved in linking cellular metabolism (phosphate and glucose metabolism) with other core functions including protein synthesis and degradation, calcium signaling and cell growth.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding and coiled-coil domain-containing protein 1
Alternative name(s):
Calphoglin
Coiled-coil coactivator protein
Sarcoma antigen NY-SAR-3
Gene namesi
Name:CALCOCO1
Synonyms:KIAA1536
ORF Names:PP13275, UNQ2436/PRO4996
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000012822.15
HGNCiHGNC:29306 CALCOCO1
neXtProtiNX_Q9P1Z2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi57658
OpenTargetsiENSG00000012822
PharmGKBiPA128394699

Polymorphism and mutation databases

BioMutaiCALCOCO1
DMDMi160017736

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003088991 – 691Calcium-binding and coiled-coil domain-containing protein 1Add BLAST691

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei4PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P1Z2
MaxQBiQ9P1Z2
PaxDbiQ9P1Z2
PeptideAtlasiQ9P1Z2
PRIDEiQ9P1Z2
ProteomicsDBi83683
83684 [Q9P1Z2-2]
83685 [Q9P1Z2-3]
83686 [Q9P1Z2-4]

PTM databases

iPTMnetiQ9P1Z2
PhosphoSitePlusiQ9P1Z2

Miscellaneous databases

PMAP-CutDBiQ9P1Z2

Expressioni

Gene expression databases

BgeeiENSG00000012822 Expressed in 230 organ(s), highest expression level in esophagus
CleanExiHS_CALCOCO1
ExpressionAtlasiQ9P1Z2 baseline and differential
GenevisibleiQ9P1Z2 HS

Organism-specific databases

HPAiHPA038313
HPA038314

Interactioni

Subunit structurei

Part of a calphoglin complex consisting of CALCOCO1, PPA1 and PGM (Ref. 1). Interacts with the bHLH-PAS domains of GRIP1, AHR and ARNT. Interacts with CTNNB1 via both its N- and C-terminal regions. Interacts with EP300. Interacts with CCAR1 (via N-terminus) and GATA1 (By similarity).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121692, 40 interactors
DIPiDIP-47322N
IntActiQ9P1Z2, 33 interactors
STRINGi9606.ENSP00000449960

Structurei

3D structure databases

ProteinModelPortaliQ9P1Z2
SMRiQ9P1Z2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 190N-terminal AD (CTNNB1 binding site)By similarityAdd BLAST190
Regioni1 – 30p300 KIX-bindingBy similarityAdd BLAST30
Regioni45 – 125Interaction with GATA1By similarityAdd BLAST81
Regioni501 – 691C-terminal AD (CTNNB1 binding site); interaction with CCAR1By similarityAdd BLAST191

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili145 – 205Sequence analysisAdd BLAST61
Coiled coili232 – 339Sequence analysisAdd BLAST108
Coiled coili417 – 514Sequence analysisAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi367 – 372Poly-Ala6

Domaini

The C-terminal activation region (AD) is used for downstream signaling. Seems to be essential for coactivator function with nuclear receptors and with the aryl hydrocarbon receptor (By similarity).By similarity
The N-terminal activation region (AD) is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CTNNB1. Contains a EP3000 binding region which is important for synergistic cooperation (By similarity).By similarity
Recruitment by nuclear receptors is accomplished by the interaction of the coiled-coiled domain with p160 coactivators.By similarity

Sequence similaritiesi

Belongs to the CALCOCO family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IHKH Eukaryota
ENOG410ZVZ6 LUCA
GeneTreeiENSGT00530000063216
HOVERGENiHBG107573
InParanoidiQ9P1Z2
OMAiYDMASGF
OrthoDBiEOG091G01W2
PhylomeDBiQ9P1Z2
TreeFamiTF329501

Family and domain databases

InterProiView protein in InterPro
IPR012852 CALCOCO1-like
PfamiView protein in Pfam
PF07888 CALCOCO1, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P1Z2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEESPLSRAP SRGGVNFLNV ARTYIPNTKV ECHYTLPPGT MPSASDWIGI
60 70 80 90 100
FKVEAACVRD YHTFVWSSVP ESTTDGSPIH TSVQFQASYL PKPGAQLYQF
110 120 130 140 150
RYVNRQGQVC GQSPPFQFRE PRPMDELVTL EEADGGSDIL LVVPKATVLQ
160 170 180 190 200
NQLDESQQER NDLMQLKLQL EGQVTELRSR VQELERALAT ARQEHTELME
210 220 230 240 250
QYKGISRSHG EITEERDILS RQQGDHVARI LELEDDIQTI SEKVLTKEVE
260 270 280 290 300
LDRLRDTVKA LTREQEKLLG QLKEVQADKE QSEAELQVAQ QENHHLNLDL
310 320 330 340 350
KEAKSWQEEQ SAQAQRLKDK VAQMKDTLGQ AQQRVAELEP LKEQLRGAQE
360 370 380 390 400
LAASSQQKAT LLGEELASAA AARDRTIAEL HRSRLEVAEV NGRLAELGLH
410 420 430 440 450
LKEEKCQWSK ERAGLLQSVE AEKDKILKLS AEILRLEKAV QEERTQNQVF
460 470 480 490 500
KTELAREKDS SLVQLSESKR ELTELRSALR VLQKEKEQLQ EEKQELLEYM
510 520 530 540 550
RKLEARLEKV ADEKWNEDAT TEDEEAAVGL SCPAALTDSE DESPEDMRLP
560 570 580 590 600
PYGLCERGDP GSSPAGPREA SPLVVISQPA PISPHLSGPA EDSSSDSEAE
610 620 630 640 650
DEKSVLMAAV QSGGEEANLL LPELGSAFYD MASGFTVGTL SETSTGGPAT
660 670 680 690
PTWKECPICK ERFPAESDKD ALEDHMDGHF FFSTQDPFTF E
Length:691
Mass (Da):77,336
Last modified:October 23, 2007 - v2
Checksum:i06A4C6BAB896759F
GO
Isoform 2 (identifier: Q9P1Z2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     633-691: SGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE → R

Show »
Length:633
Mass (Da):70,978
Checksum:i44493B60B4E3BBF1
GO
Isoform 3 (identifier: Q9P1Z2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-598: Missing.

Note: No experimental confirmation available.
Show »
Length:690
Mass (Da):77,207
Checksum:iB9369254792722D2
GO
Isoform 4 (identifier: Q9P1Z2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-119: Missing.
     287-338: Missing.

Note: No experimental confirmation available.
Show »
Length:606
Mass (Da):67,542
Checksum:i1166472275D9A569
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRW8H3BRW8_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
232Annotation score:
F8VQE3F8VQE3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
164Annotation score:
F8VUB3F8VUB3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
120Annotation score:
F8W0X2F8W0X2_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
149Annotation score:
F8VZI3F8VZI3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
134Annotation score:
F8VPN1F8VPN1_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
115Annotation score:
F8VRQ9F8VRQ9_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
159Annotation score:
F8VXS2F8VXS2_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
160Annotation score:
F8VWP8F8VWP8_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
104Annotation score:

Sequence cautioni

The sequence BAA96060 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti381H → R in BAG53720 (PubMed:14702039).Curated1
Sequence conflicti486K → R in CAG38598 (Ref. 7) Curated1
Sequence conflicti660K → E in CAG38598 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036881393R → K1 PublicationCorresponds to variant dbSNP:rs3741659Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04147187 – 119Missing in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_041472287 – 338Missing in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_029052598Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_029053633 – 691SGFTV…PFTFE → R in isoform 2. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY563137 mRNA Translation: AAT68474.1
AB040969 mRNA Translation: BAA96060.1 Different initiation.
AL136895 mRNA Translation: CAB66829.1
AY358397 mRNA Translation: AAQ88763.1
AK122773 mRNA Translation: BAG53720.1
AK027881 mRNA Translation: BAB55428.1
AF370415 mRNA Translation: AAQ15251.1
CR533567 mRNA Translation: CAG38598.1
CH471054 Genomic DNA Translation: EAW96728.1
BC003177 mRNA Translation: AAH03177.1
AY211909 mRNA Translation: AAO65163.1
CCDSiCCDS44908.1 [Q9P1Z2-4]
CCDS8864.1 [Q9P1Z2-1]
RefSeqiNP_001137154.1, NM_001143682.1 [Q9P1Z2-4]
NP_065949.1, NM_020898.2 [Q9P1Z2-1]
XP_016875196.1, XM_017019707.1 [Q9P1Z2-1]
UniGeneiHs.156667

Genome annotation databases

EnsembliENST00000262059; ENSP00000262059; ENSG00000012822 [Q9P1Z2-3]
ENST00000430117; ENSP00000397189; ENSG00000012822 [Q9P1Z2-4]
ENST00000548263; ENSP00000447647; ENSG00000012822 [Q9P1Z2-2]
ENST00000550804; ENSP00000449960; ENSG00000012822 [Q9P1Z2-1]
GeneIDi57658
KEGGihsa:57658
UCSCiuc001sef.4 human [Q9P1Z2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY563137 mRNA Translation: AAT68474.1
AB040969 mRNA Translation: BAA96060.1 Different initiation.
AL136895 mRNA Translation: CAB66829.1
AY358397 mRNA Translation: AAQ88763.1
AK122773 mRNA Translation: BAG53720.1
AK027881 mRNA Translation: BAB55428.1
AF370415 mRNA Translation: AAQ15251.1
CR533567 mRNA Translation: CAG38598.1
CH471054 Genomic DNA Translation: EAW96728.1
BC003177 mRNA Translation: AAH03177.1
AY211909 mRNA Translation: AAO65163.1
CCDSiCCDS44908.1 [Q9P1Z2-4]
CCDS8864.1 [Q9P1Z2-1]
RefSeqiNP_001137154.1, NM_001143682.1 [Q9P1Z2-4]
NP_065949.1, NM_020898.2 [Q9P1Z2-1]
XP_016875196.1, XM_017019707.1 [Q9P1Z2-1]
UniGeneiHs.156667

3D structure databases

ProteinModelPortaliQ9P1Z2
SMRiQ9P1Z2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121692, 40 interactors
DIPiDIP-47322N
IntActiQ9P1Z2, 33 interactors
STRINGi9606.ENSP00000449960

PTM databases

iPTMnetiQ9P1Z2
PhosphoSitePlusiQ9P1Z2

Polymorphism and mutation databases

BioMutaiCALCOCO1
DMDMi160017736

Proteomic databases

EPDiQ9P1Z2
MaxQBiQ9P1Z2
PaxDbiQ9P1Z2
PeptideAtlasiQ9P1Z2
PRIDEiQ9P1Z2
ProteomicsDBi83683
83684 [Q9P1Z2-2]
83685 [Q9P1Z2-3]
83686 [Q9P1Z2-4]

Protocols and materials databases

DNASUi57658
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262059; ENSP00000262059; ENSG00000012822 [Q9P1Z2-3]
ENST00000430117; ENSP00000397189; ENSG00000012822 [Q9P1Z2-4]
ENST00000548263; ENSP00000447647; ENSG00000012822 [Q9P1Z2-2]
ENST00000550804; ENSP00000449960; ENSG00000012822 [Q9P1Z2-1]
GeneIDi57658
KEGGihsa:57658
UCSCiuc001sef.4 human [Q9P1Z2-1]

Organism-specific databases

CTDi57658
DisGeNETi57658
EuPathDBiHostDB:ENSG00000012822.15
GeneCardsiCALCOCO1
H-InvDBiHIX0129676
HGNCiHGNC:29306 CALCOCO1
HPAiHPA038313
HPA038314
neXtProtiNX_Q9P1Z2
OpenTargetsiENSG00000012822
PharmGKBiPA128394699
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHKH Eukaryota
ENOG410ZVZ6 LUCA
GeneTreeiENSGT00530000063216
HOVERGENiHBG107573
InParanoidiQ9P1Z2
OMAiYDMASGF
OrthoDBiEOG091G01W2
PhylomeDBiQ9P1Z2
TreeFamiTF329501

Miscellaneous databases

ChiTaRSiCALCOCO1 human
GeneWikiiCALCOCO1
GenomeRNAii57658
PMAP-CutDBiQ9P1Z2
PROiPR:Q9P1Z2

Gene expression databases

BgeeiENSG00000012822 Expressed in 230 organ(s), highest expression level in esophagus
CleanExiHS_CALCOCO1
ExpressionAtlasiQ9P1Z2 baseline and differential
GenevisibleiQ9P1Z2 HS

Family and domain databases

InterProiView protein in InterPro
IPR012852 CALCOCO1-like
PfamiView protein in Pfam
PF07888 CALCOCO1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCACO1_HUMAN
AccessioniPrimary (citable) accession number: Q9P1Z2
Secondary accession number(s): B3KVA8
, Q6FI59, Q71RC3, Q86WF8, Q96JU3, Q9H090
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: September 12, 2018
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again