Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9P1Z2 (CACO1_HUMAN)

Entry version 144 (10 Feb 2021)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Calcium-binding and coiled-coil domain-containing protein 1

Gene

CALCOCO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions (By similarity). In association with CCAR1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).By similarity1 Publication
Seems to enhance inorganic pyrophosphatase thus activating phosphogluomutase (PMG). Probably functions as component of the calphoglin complex, which is involved in linking cellular metabolism (phosphate and glucose metabolism) with other core functions including protein synthesis and degradation, calcium signaling and cell growth.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri653 – 679UBZ1-typePROSITE-ProRule annotationAdd BLAST27

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation, Wnt signaling pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9P1Z2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-binding and coiled-coil domain-containing protein 1
Alternative name(s):
Calphoglin
Coiled-coil coactivator protein
Sarcoma antigen NY-SAR-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CALCOCO1
Synonyms:KIAA1536
ORF Names:PP13275, UNQ2436/PRO4996
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:29306, CALCOCO1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9P1Z2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000012822.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		57658

Open Targets

More...OpenTargetsi		ENSG00000012822

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA128394699

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9P1Z2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CALCOCO1

Domain mapping of disease mutations (DMDM)

More...DMDMi		160017736

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003088991 – 691Calcium-binding and coiled-coil domain-containing protein 1Add BLAST691

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei4PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1234
CPTAC-1235

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9P1Z2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9P1Z2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9P1Z2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9P1Z2

PeptideAtlas

More...PeptideAtlasi		Q9P1Z2

PRoteomics IDEntifications database

More...PRIDEi		Q9P1Z2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83683 [Q9P1Z2-1]
83684 [Q9P1Z2-2]
83685 [Q9P1Z2-3]
83686 [Q9P1Z2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9P1Z2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9P1Z2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000012822, Expressed in esophagus and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9P1Z2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9P1Z2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000012822, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a calphoglin complex consisting of CALCOCO1, PPA1 and PGM (Ref. 1).

Interacts with the bHLH-PAS domains of GRIP1, AHR and ARNT.

Interacts with CTNNB1 via both its N- and C-terminal regions.

Interacts with EP300.

Interacts with CCAR1 (via N-terminus) and GATA1 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		121692, 50 interactors

Database of interacting proteins

More...DIPi		DIP-47322N

Protein interaction database and analysis system

More...IntActi		Q9P1Z2, 44 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000449960

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9P1Z2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9P1Z2

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 190N-terminal AD (CTNNB1 binding site)By similarityAdd BLAST190
Regioni1 – 30p300 KIX-bindingBy similarityAdd BLAST30
Regioni45 – 125Interaction with GATA1By similarityAdd BLAST81
Regioni501 – 691C-terminal AD (CTNNB1 binding site); interaction with CCAR1By similarityAdd BLAST191

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili145 – 205Sequence analysisAdd BLAST61
Coiled coili232 – 339Sequence analysisAdd BLAST108
Coiled coili417 – 514Sequence analysisAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi367 – 372Poly-Ala6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal activation region (AD) is used for downstream signaling. Seems to be essential for coactivator function with nuclear receptors and with the aryl hydrocarbon receptor (By similarity).By similarity
The N-terminal activation region (AD) is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CTNNB1. Contains a EP3000 binding region which is important for synergistic cooperation (By similarity).By similarity
Recruitment by nuclear receptors is accomplished by the interaction of the coiled-coiled domain with p160 coactivators.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CALCOCO family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri653 – 679UBZ1-typePROSITE-ProRule annotationAdd BLAST27

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QR9J, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183025

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_028857_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9P1Z2

Identification of Orthologs from Complete Genome Data

More...OMAi		SLCEQGQ

Database of Orthologous Groups

More...OrthoDBi		179838at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9P1Z2

TreeFam database of animal gene trees

More...TreeFami		TF329501

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR012852, CALCOCO1-like
IPR041641, CALCOCO1/2_Zn_UBZ1
IPR041611, SKICH

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07888, CALCOCO1, 1 hit
PF17751, SKICH, 1 hit
PF18112, Zn-C2H2_12, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51905, ZF_UBZ1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P1Z2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEESPLSRAP SRGGVNFLNV ARTYIPNTKV ECHYTLPPGT MPSASDWIGI 
        60         70         80         90        100
FKVEAACVRD YHTFVWSSVP ESTTDGSPIH TSVQFQASYL PKPGAQLYQF 
       110        120        130        140        150
RYVNRQGQVC GQSPPFQFRE PRPMDELVTL EEADGGSDIL LVVPKATVLQ 
       160        170        180        190        200
NQLDESQQER NDLMQLKLQL EGQVTELRSR VQELERALAT ARQEHTELME 
       210        220        230        240        250
QYKGISRSHG EITEERDILS RQQGDHVARI LELEDDIQTI SEKVLTKEVE 
       260        270        280        290        300
LDRLRDTVKA LTREQEKLLG QLKEVQADKE QSEAELQVAQ QENHHLNLDL 
       310        320        330        340        350
KEAKSWQEEQ SAQAQRLKDK VAQMKDTLGQ AQQRVAELEP LKEQLRGAQE 
       360        370        380        390        400
LAASSQQKAT LLGEELASAA AARDRTIAEL HRSRLEVAEV NGRLAELGLH 
       410        420        430        440        450
LKEEKCQWSK ERAGLLQSVE AEKDKILKLS AEILRLEKAV QEERTQNQVF 
       460        470        480        490        500
KTELAREKDS SLVQLSESKR ELTELRSALR VLQKEKEQLQ EEKQELLEYM 
       510        520        530        540        550
RKLEARLEKV ADEKWNEDAT TEDEEAAVGL SCPAALTDSE DESPEDMRLP 
       560        570        580        590        600
PYGLCERGDP GSSPAGPREA SPLVVISQPA PISPHLSGPA EDSSSDSEAE 
       610        620        630        640        650
DEKSVLMAAV QSGGEEANLL LPELGSAFYD MASGFTVGTL SETSTGGPAT 
       660        670        680        690 
PTWKECPICK ERFPAESDKD ALEDHMDGHF FFSTQDPFTF E
Length:691
Mass (Da):77,336
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i06A4C6BAB896759F
GO
Isoform 2 (identifier: Q9P1Z2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     633-691: SGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE → R

Show »
Length:633
Mass (Da):70,978
Checksum:i44493B60B4E3BBF1
GO
Isoform 3 (identifier: Q9P1Z2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-598: Missing.

Show »
Length:690
Mass (Da):77,207
Checksum:iB9369254792722D2
GO
Isoform 4 (identifier: Q9P1Z2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-119: Missing.
     287-338: Missing.

Show »
Length:606
Mass (Da):67,542
Checksum:i1166472275D9A569
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRW8H3BRW8_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXS2F8VXS2_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUB3F8VUB3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZI3F8VZI3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPN1F8VPN1_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VQE3F8VQE3_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWP8F8VWP8_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W0X2F8W0X2_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VRQ9F8VRQ9_HUMAN
Calcium-binding and coiled-coil dom...
CALCOCO1
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA96060 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti381H → R in BAG53720 (PubMed:14702039).Curated1
Sequence conflicti486K → R in CAG38598 (Ref. 7) Curated1
Sequence conflicti660K → E in CAG38598 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036881393R → K1 PublicationCorresponds to variant dbSNP:rs3741659Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04147187 – 119Missing in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_041472287 – 338Missing in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_029052598Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_029053633 – 691SGFTV…PFTFE → R in isoform 2. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY563137 mRNA Translation: AAT68474.1
AB040969 mRNA Translation: BAA96060.1 Different initiation.
AL136895 mRNA Translation: CAB66829.1
AY358397 mRNA Translation: AAQ88763.1
AK122773 mRNA Translation: BAG53720.1
AK027881 mRNA Translation: BAB55428.1
AF370415 mRNA Translation: AAQ15251.1
CR533567 mRNA Translation: CAG38598.1
CH471054 Genomic DNA Translation: EAW96728.1
BC003177 mRNA Translation: AAH03177.1
AY211909 mRNA Translation: AAO65163.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44908.1 [Q9P1Z2-4]
CCDS8864.1 [Q9P1Z2-1]

NCBI Reference Sequences

More...RefSeqi		NP_001137154.1, NM_001143682.1 [Q9P1Z2-4]
NP_065949.1, NM_020898.2 [Q9P1Z2-1]
XP_016875196.1, XM_017019707.1 [Q9P1Z2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262059; ENSP00000262059; ENSG00000012822 [Q9P1Z2-3]
ENST00000430117; ENSP00000397189; ENSG00000012822 [Q9P1Z2-4]
ENST00000548263; ENSP00000447647; ENSG00000012822 [Q9P1Z2-2]
ENST00000550804; ENSP00000449960; ENSG00000012822 [Q9P1Z2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		57658

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:57658

UCSC genome browser

More...UCSCi		uc001sef.4, human [Q9P1Z2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY563137 mRNA Translation: AAT68474.1
AB040969 mRNA Translation: BAA96060.1 Different initiation.
AL136895 mRNA Translation: CAB66829.1
AY358397 mRNA Translation: AAQ88763.1
AK122773 mRNA Translation: BAG53720.1
AK027881 mRNA Translation: BAB55428.1
AF370415 mRNA Translation: AAQ15251.1
CR533567 mRNA Translation: CAG38598.1
CH471054 Genomic DNA Translation: EAW96728.1
BC003177 mRNA Translation: AAH03177.1
AY211909 mRNA Translation: AAO65163.1
CCDSiCCDS44908.1 [Q9P1Z2-4]
CCDS8864.1 [Q9P1Z2-1]
RefSeqiNP_001137154.1, NM_001143682.1 [Q9P1Z2-4]
NP_065949.1, NM_020898.2 [Q9P1Z2-1]
XP_016875196.1, XM_017019707.1 [Q9P1Z2-1]

3D structure databases

SMRiQ9P1Z2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi121692, 50 interactors
DIPiDIP-47322N
IntActiQ9P1Z2, 44 interactors
STRINGi9606.ENSP00000449960

PTM databases

iPTMnetiQ9P1Z2
PhosphoSitePlusiQ9P1Z2

Genetic variation databases

BioMutaiCALCOCO1
DMDMi160017736

Proteomic databases

CPTACiCPTAC-1234
CPTAC-1235
jPOSTiQ9P1Z2
MassIVEiQ9P1Z2
MaxQBiQ9P1Z2
PaxDbiQ9P1Z2
PeptideAtlasiQ9P1Z2
PRIDEiQ9P1Z2
ProteomicsDBi83683 [Q9P1Z2-1]
83684 [Q9P1Z2-2]
83685 [Q9P1Z2-3]
83686 [Q9P1Z2-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27237, 89 antibodies

The DNASU plasmid repository

More...DNASUi		57658

Genome annotation databases

EnsembliENST00000262059; ENSP00000262059; ENSG00000012822 [Q9P1Z2-3]
ENST00000430117; ENSP00000397189; ENSG00000012822 [Q9P1Z2-4]
ENST00000548263; ENSP00000447647; ENSG00000012822 [Q9P1Z2-2]
ENST00000550804; ENSP00000449960; ENSG00000012822 [Q9P1Z2-1]
GeneIDi57658
KEGGihsa:57658
UCSCiuc001sef.4, human [Q9P1Z2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		57658
DisGeNETi57658

GeneCards: human genes, protein and diseases

More...GeneCardsi		CALCOCO1
HGNCiHGNC:29306, CALCOCO1
HPAiENSG00000012822, Low tissue specificity
neXtProtiNX_Q9P1Z2
OpenTargetsiENSG00000012822
PharmGKBiPA128394699
VEuPathDBiHostDB:ENSG00000012822.15

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QR9J, Eukaryota
GeneTreeiENSGT00950000183025
HOGENOMiCLU_028857_0_0_1
InParanoidiQ9P1Z2
OMAiSLCEQGQ
OrthoDBi179838at2759
PhylomeDBiQ9P1Z2
TreeFamiTF329501

Enzyme and pathway databases

PathwayCommonsiQ9P1Z2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		57658, 7 hits in 879 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CALCOCO1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CALCOCO1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		57658
PharosiQ9P1Z2, Tbio

Protein Ontology

More...PROi		PR:Q9P1Z2
RNActiQ9P1Z2, protein

Gene expression databases

BgeeiENSG00000012822, Expressed in esophagus and 241 other tissues
ExpressionAtlasiQ9P1Z2, baseline and differential
GenevisibleiQ9P1Z2, HS

Family and domain databases

InterProiView protein in InterPro
IPR012852, CALCOCO1-like
IPR041641, CALCOCO1/2_Zn_UBZ1
IPR041611, SKICH
PfamiView protein in Pfam
PF07888, CALCOCO1, 1 hit
PF17751, SKICH, 1 hit
PF18112, Zn-C2H2_12, 1 hit
PROSITEiView protein in PROSITE
PS51905, ZF_UBZ1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACO1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P1Z2
Secondary accession number(s): B3KVA8
, Q6FI59, Q71RC3, Q86WF8, Q96JU3, Q9H090
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: February 10, 2021
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again