Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-10

Gene

SEPT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential).Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei128GTP; via amide nitrogenBy similarity1
Binding sitei263GTP; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei278GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi73 – 80GTPBy similarity8
Nucleotide bindingi209 – 217GTPBy similarity9

GO - Molecular functioni

  • GTPase activity Source: GO_Central
  • GTP binding Source: UniProtKB-KW
  • protein-containing complex scaffold activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division
LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-10
Gene namesi
Name:SEPT10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000186522.14
HGNCiHGNC:14349 SEPT10
MIMi611737 gene
neXtProtiNX_Q9P0V9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186522
PharmGKBiPA134918683

Polymorphism and mutation databases

BioMutaiSEPT10
DMDMi160400057

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001735381 – 454Septin-10Add BLAST454

Proteomic databases

EPDiQ9P0V9
MaxQBiQ9P0V9
PaxDbiQ9P0V9
PeptideAtlasiQ9P0V9
PRIDEiQ9P0V9
ProteomicsDBi83606
83607 [Q9P0V9-2]
83608 [Q9P0V9-3]

PTM databases

iPTMnetiQ9P0V9
PhosphoSitePlusiQ9P0V9

Expressioni

Tissue specificityi

Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines.2 Publications

Gene expression databases

BgeeiENSG00000186522 Expressed in 239 organ(s), highest expression level in mouth mucosa
CleanExiHS_SEPT10
ExpressionAtlasiQ9P0V9 baseline and differential
GenevisibleiQ9P0V9 HS

Organism-specific databases

HPAiHPA047860
HPA056304
HPA060310

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi127339, 36 interactors
IntActiQ9P0V9, 6 interactors
STRINGi9606.ENSP00000380824

Structurei

3D structure databases

ProteinModelPortaliQ9P0V9
SMRiQ9P0V9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini63 – 329Septin-type GPROSITE-ProRule annotationAdd BLAST267

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni73 – 80G1 motifPROSITE-ProRule annotation8
Regioni125 – 128G3 motifPROSITE-ProRule annotation4
Regioni208 – 211G4 motifPROSITE-ProRule annotation4

Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00910000144070
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ9P0V9
KOiK16940
PhylomeDBiQ9P0V9
TreeFamiTF101080

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P0V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSEVARHL LFQSHMATKT TCMSSQGSDD EQIKRENIRS LTMSGHVGFE
60 70 80 90 100
SLPDQLVNRS IQQGFCFNIL CVGETGIGKS TLIDTLFNTN FEDYESSHFC
110 120 130 140 150
PNVKLKAQTY ELQESNVQLK LTIVNTVGFG DQINKEESYQ PIVDYIDAQF
160 170 180 190 200
EAYLQEELKI KRSLFTYHDS RIHVCLYFIS PTGHSLKTLD LLTMKNLDSK
210 220 230 240 250
VNIIPVIAKA DTVSKTELQK FKIKLMSELV SNGVQIYQFP TDDDTIAKVN
260 270 280 290 300
AAMNGQLPFA VVGSMDEVKV GNKMVKARQY PWGVVQVENE NHCDFVKLRE
310 320 330 340 350
MLICTNMEDL REQTHTRHYE LYRRCKLEEM GFTDVGPENK PVSVQETYEA
360 370 380 390 400
KRHEFHGERQ RKEEEMKQMF VQRVKEKEAI LKEAERELQA KFEHLKRLHQ
410 420 430 440 450
EERMKLEEKR RLLEEEIIAF SKKKATSEIF HSQSFLATGS NLRKDKDRKN

SNFL
Length:454
Mass (Da):52,593
Last modified:October 23, 2007 - v2
Checksum:i95C8F7FAA266BC10
GO
Isoform 2 (identifier: Q9P0V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN

Show »
Length:503
Mass (Da):58,136
Checksum:i4313FEB8875291E9
GO
Isoform 3 (identifier: Q9P0V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-33: Missing.

Show »
Length:431
Mass (Da):50,065
Checksum:iCF6F70189AA897DA
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5ME97B5ME97_HUMAN
Septin 10, isoform CRA_c
SEPT10 hCG_27895
544Annotation score:
E7EW69E7EW69_HUMAN
Septin-10
SEPT10
450Annotation score:
E7EX04E7EX04_HUMAN
Septin-10
SEPT10
473Annotation score:
F5H1F2F5H1F2_HUMAN
Septin-10
SEPT10
98Annotation score:
C9JEQ7C9JEQ7_HUMAN
Septin-10
SEPT10
97Annotation score:
F5GYV2F5GYV2_HUMAN
Septin-10
SEPT10
26Annotation score:
C9JNR7C9JNR7_HUMAN
Septin-10
SEPT10
61Annotation score:
F8WC85F8WC85_HUMAN
Septin-10
SEPT10
48Annotation score:
C9JEW2C9JEW2_HUMAN
Septin-10
SEPT10
57Annotation score:
F5H1W3F5H1W3_HUMAN
Septin-10
SEPT10
38Annotation score:

Sequence cautioni

The sequence AAF67469 differs from that shown. Reason: Frameshift at position 444.Curated
Isoform 2 : The sequence AAH50345 differs from that shown. Reason: Frameshift at position 503.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051936189L → P. Corresponds to variant dbSNP:rs3829701Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04147911 – 33Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_014091450 – 454NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF146760 mRNA Translation: AAF67469.1 Frameshift.
AK092033 mRNA Translation: BAG52471.1
AK021681 mRNA Translation: BAB13873.1
AC140485 Genomic DNA Translation: AAY24142.1
CH471182 Genomic DNA Translation: EAW53864.1
BC020502 mRNA Translation: AAH20502.1
BC050345 mRNA Translation: AAH50345.2 Frameshift.
CCDSiCCDS42726.1 [Q9P0V9-3]
CCDS46383.1 [Q9P0V9-1]
RefSeqiNP_001308425.1, NM_001321496.1
NP_001308427.1, NM_001321498.1
NP_001308428.1, NM_001321499.1
NP_001308429.1, NM_001321500.1
NP_001308430.1, NM_001321501.1
NP_001308431.1, NM_001321502.1
NP_001308432.1, NM_001321503.1
NP_001308433.1, NM_001321504.1
NP_001308434.1, NM_001321505.1
NP_001308435.1, NM_001321506.1
NP_001308436.1, NM_001321507.1
NP_001308437.1, NM_001321508.1
NP_001308438.1, NM_001321509.1
NP_001308439.1, NM_001321510.1
NP_001308440.1, NM_001321511.1
NP_001308441.1, NM_001321512.1
NP_653311.1, NM_144710.4 [Q9P0V9-1]
NP_848699.1, NM_178584.3 [Q9P0V9-3]
UniGeneiHs.469615

Genome annotation databases

EnsembliENST00000397712; ENSP00000380824; ENSG00000186522 [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522 [Q9P0V9-3]
GeneIDi151011
KEGGihsa:151011
UCSCiuc002tew.5 human [Q9P0V9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF146760 mRNA Translation: AAF67469.1 Frameshift.
AK092033 mRNA Translation: BAG52471.1
AK021681 mRNA Translation: BAB13873.1
AC140485 Genomic DNA Translation: AAY24142.1
CH471182 Genomic DNA Translation: EAW53864.1
BC020502 mRNA Translation: AAH20502.1
BC050345 mRNA Translation: AAH50345.2 Frameshift.
CCDSiCCDS42726.1 [Q9P0V9-3]
CCDS46383.1 [Q9P0V9-1]
RefSeqiNP_001308425.1, NM_001321496.1
NP_001308427.1, NM_001321498.1
NP_001308428.1, NM_001321499.1
NP_001308429.1, NM_001321500.1
NP_001308430.1, NM_001321501.1
NP_001308431.1, NM_001321502.1
NP_001308432.1, NM_001321503.1
NP_001308433.1, NM_001321504.1
NP_001308434.1, NM_001321505.1
NP_001308435.1, NM_001321506.1
NP_001308436.1, NM_001321507.1
NP_001308437.1, NM_001321508.1
NP_001308438.1, NM_001321509.1
NP_001308439.1, NM_001321510.1
NP_001308440.1, NM_001321511.1
NP_001308441.1, NM_001321512.1
NP_653311.1, NM_144710.4 [Q9P0V9-1]
NP_848699.1, NM_178584.3 [Q9P0V9-3]
UniGeneiHs.469615

3D structure databases

ProteinModelPortaliQ9P0V9
SMRiQ9P0V9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127339, 36 interactors
IntActiQ9P0V9, 6 interactors
STRINGi9606.ENSP00000380824

PTM databases

iPTMnetiQ9P0V9
PhosphoSitePlusiQ9P0V9

Polymorphism and mutation databases

BioMutaiSEPT10
DMDMi160400057

Proteomic databases

EPDiQ9P0V9
MaxQBiQ9P0V9
PaxDbiQ9P0V9
PeptideAtlasiQ9P0V9
PRIDEiQ9P0V9
ProteomicsDBi83606
83607 [Q9P0V9-2]
83608 [Q9P0V9-3]

Protocols and materials databases

DNASUi151011
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397712; ENSP00000380824; ENSG00000186522 [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522 [Q9P0V9-3]
GeneIDi151011
KEGGihsa:151011
UCSCiuc002tew.5 human [Q9P0V9-1]

Organism-specific databases

CTDi151011
EuPathDBiHostDB:ENSG00000186522.14
GeneCardsiSEPT10
H-InvDBiHIX0018271
HGNCiHGNC:14349 SEPT10
HPAiHPA047860
HPA056304
HPA060310
MIMi611737 gene
neXtProtiNX_Q9P0V9
OpenTargetsiENSG00000186522
PharmGKBiPA134918683
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00910000144070
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ9P0V9
KOiK16940
PhylomeDBiQ9P0V9
TreeFamiTF101080

Miscellaneous databases

ChiTaRSiSEPT10 human
GenomeRNAii151011
PROiPR:Q9P0V9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186522 Expressed in 239 organ(s), highest expression level in mouth mucosa
CleanExiHS_SEPT10
ExpressionAtlasiQ9P0V9 baseline and differential
GenevisibleiQ9P0V9 HS

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSEP10_HUMAN
AccessioniPrimary (citable) accession number: Q9P0V9
Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 23, 2007
Last modified: November 7, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again