Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (13 Feb 2019)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Septin-10

Gene

SEPT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential).Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei128GTP; via amide nitrogenBy similarity1
Binding sitei263GTP; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei278GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi73 – 80GTPBy similarity8
Nucleotide bindingi209 – 217GTPBy similarity9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activity Source: GO_Central
  • GTP binding Source: UniProtKB-KW
  • protein-containing complex scaffold activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division
LigandGTP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Septin-10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEPT10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000186522.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14349 SEPT10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611737 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9P0V9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000186522

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134918683

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEPT10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160400057

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001735381 – 454Septin-10Add BLAST454

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9P0V9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9P0V9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9P0V9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9P0V9

PeptideAtlas

More...
PeptideAtlasi
Q9P0V9

PRoteomics IDEntifications database

More...
PRIDEi
Q9P0V9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
83606
83607 [Q9P0V9-2]
83608 [Q9P0V9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9P0V9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9P0V9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186522 Expressed in 239 organ(s), highest expression level in mouth mucosa

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9P0V9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9P0V9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047860
HPA056304
HPA060310

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127339, 37 interactors

Protein interaction database and analysis system

More...
IntActi
Q9P0V9, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380824

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9P0V9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9P0V9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini63 – 329Septin-type GPROSITE-ProRule annotationAdd BLAST267

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni73 – 80G1 motifPROSITE-ProRule annotation8
Regioni125 – 128G3 motifPROSITE-ProRule annotation4
Regioni208 – 211G4 motifPROSITE-ProRule annotation4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2655 Eukaryota
COG5019 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155238

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233586

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG065093

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9P0V9

KEGG Orthology (KO)

More...
KOi
K16940

Database of Orthologous Groups

More...
OrthoDBi
845354at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9P0V9

TreeFam database of animal gene trees

More...
TreeFami
TF101080

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01850 CDC_Septin, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00735 Septin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF006698 Septin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51719 G_SEPTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P0V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSEVARHL LFQSHMATKT TCMSSQGSDD EQIKRENIRS LTMSGHVGFE
60 70 80 90 100
SLPDQLVNRS IQQGFCFNIL CVGETGIGKS TLIDTLFNTN FEDYESSHFC
110 120 130 140 150
PNVKLKAQTY ELQESNVQLK LTIVNTVGFG DQINKEESYQ PIVDYIDAQF
160 170 180 190 200
EAYLQEELKI KRSLFTYHDS RIHVCLYFIS PTGHSLKTLD LLTMKNLDSK
210 220 230 240 250
VNIIPVIAKA DTVSKTELQK FKIKLMSELV SNGVQIYQFP TDDDTIAKVN
260 270 280 290 300
AAMNGQLPFA VVGSMDEVKV GNKMVKARQY PWGVVQVENE NHCDFVKLRE
310 320 330 340 350
MLICTNMEDL REQTHTRHYE LYRRCKLEEM GFTDVGPENK PVSVQETYEA
360 370 380 390 400
KRHEFHGERQ RKEEEMKQMF VQRVKEKEAI LKEAERELQA KFEHLKRLHQ
410 420 430 440 450
EERMKLEEKR RLLEEEIIAF SKKKATSEIF HSQSFLATGS NLRKDKDRKN

SNFL
Length:454
Mass (Da):52,593
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i95C8F7FAA266BC10
GO
Isoform 2 (identifier: Q9P0V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN

Show »
Length:503
Mass (Da):58,136
Checksum:i4313FEB8875291E9
GO
Isoform 3 (identifier: Q9P0V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-33: Missing.

Show »
Length:431
Mass (Da):50,065
Checksum:iCF6F70189AA897DA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5ME97B5ME97_HUMAN
Septin 10, isoform CRA_c
SEPT10 hCG_27895
544Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EW69E7EW69_HUMAN
Septin-10
SEPT10
450Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EX04E7EX04_HUMAN
Septin-10
SEPT10
473Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1F2F5H1F2_HUMAN
Septin-10
SEPT10
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JEQ7C9JEQ7_HUMAN
Septin-10
SEPT10
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYV2F5GYV2_HUMAN
Septin-10
SEPT10
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNR7C9JNR7_HUMAN
Septin-10
SEPT10
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JEW2C9JEW2_HUMAN
Septin-10
SEPT10
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC85F8WC85_HUMAN
Septin-10
SEPT10
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1W3F5H1W3_HUMAN
Septin-10
SEPT10
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF67469 differs from that shown. Reason: Frameshift at position 444.Curated
Isoform 2 : The sequence AAH50345 differs from that shown. Reason: Frameshift at position 503.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051936189L → P. Corresponds to variant dbSNP:rs3829701Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04147911 – 33Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_014091450 – 454NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF146760 mRNA Translation: AAF67469.1 Frameshift.
AK092033 mRNA Translation: BAG52471.1
AK021681 mRNA Translation: BAB13873.1
AC140485 Genomic DNA Translation: AAY24142.1
CH471182 Genomic DNA Translation: EAW53864.1
BC020502 mRNA Translation: AAH20502.1
BC050345 mRNA Translation: AAH50345.2 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42726.1 [Q9P0V9-3]
CCDS46383.1 [Q9P0V9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001308425.1, NM_001321496.1
NP_001308427.1, NM_001321498.1
NP_001308428.1, NM_001321499.1
NP_001308429.1, NM_001321500.1
NP_001308430.1, NM_001321501.1
NP_001308431.1, NM_001321502.1
NP_001308432.1, NM_001321503.1
NP_001308433.1, NM_001321504.1
NP_001308434.1, NM_001321505.1
NP_001308435.1, NM_001321506.1
NP_001308436.1, NM_001321507.1
NP_001308437.1, NM_001321508.1
NP_001308438.1, NM_001321509.1
NP_001308439.1, NM_001321510.1
NP_001308440.1, NM_001321511.1
NP_001308441.1, NM_001321512.1
NP_653311.1, NM_144710.4 [Q9P0V9-1]
NP_848699.1, NM_178584.3 [Q9P0V9-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.469615

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000397712; ENSP00000380824; ENSG00000186522 [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522 [Q9P0V9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
151011

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:151011

UCSC genome browser

More...
UCSCi
uc002tew.5 human [Q9P0V9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF146760 mRNA Translation: AAF67469.1 Frameshift.
AK092033 mRNA Translation: BAG52471.1
AK021681 mRNA Translation: BAB13873.1
AC140485 Genomic DNA Translation: AAY24142.1
CH471182 Genomic DNA Translation: EAW53864.1
BC020502 mRNA Translation: AAH20502.1
BC050345 mRNA Translation: AAH50345.2 Frameshift.
CCDSiCCDS42726.1 [Q9P0V9-3]
CCDS46383.1 [Q9P0V9-1]
RefSeqiNP_001308425.1, NM_001321496.1
NP_001308427.1, NM_001321498.1
NP_001308428.1, NM_001321499.1
NP_001308429.1, NM_001321500.1
NP_001308430.1, NM_001321501.1
NP_001308431.1, NM_001321502.1
NP_001308432.1, NM_001321503.1
NP_001308433.1, NM_001321504.1
NP_001308434.1, NM_001321505.1
NP_001308435.1, NM_001321506.1
NP_001308436.1, NM_001321507.1
NP_001308437.1, NM_001321508.1
NP_001308438.1, NM_001321509.1
NP_001308439.1, NM_001321510.1
NP_001308440.1, NM_001321511.1
NP_001308441.1, NM_001321512.1
NP_653311.1, NM_144710.4 [Q9P0V9-1]
NP_848699.1, NM_178584.3 [Q9P0V9-3]
UniGeneiHs.469615

3D structure databases

ProteinModelPortaliQ9P0V9
SMRiQ9P0V9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127339, 37 interactors
IntActiQ9P0V9, 6 interactors
STRINGi9606.ENSP00000380824

PTM databases

iPTMnetiQ9P0V9
PhosphoSitePlusiQ9P0V9

Polymorphism and mutation databases

BioMutaiSEPT10
DMDMi160400057

Proteomic databases

EPDiQ9P0V9
jPOSTiQ9P0V9
MaxQBiQ9P0V9
PaxDbiQ9P0V9
PeptideAtlasiQ9P0V9
PRIDEiQ9P0V9
ProteomicsDBi83606
83607 [Q9P0V9-2]
83608 [Q9P0V9-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
151011
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397712; ENSP00000380824; ENSG00000186522 [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522 [Q9P0V9-3]
GeneIDi151011
KEGGihsa:151011
UCSCiuc002tew.5 human [Q9P0V9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
151011
EuPathDBiHostDB:ENSG00000186522.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEPT10

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0018271
HGNCiHGNC:14349 SEPT10
HPAiHPA047860
HPA056304
HPA060310
MIMi611737 gene
neXtProtiNX_Q9P0V9
OpenTargetsiENSG00000186522
PharmGKBiPA134918683

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00940000155238
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ9P0V9
KOiK16940
OrthoDBi845354at2759
PhylomeDBiQ9P0V9
TreeFamiTF101080

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SEPT10 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
151011

Protein Ontology

More...
PROi
PR:Q9P0V9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186522 Expressed in 239 organ(s), highest expression level in mouth mucosa
ExpressionAtlasiQ9P0V9 baseline and differential
GenevisibleiQ9P0V9 HS

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEP10_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9P0V9
Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 23, 2007
Last modified: February 13, 2019
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again