Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

ADAM22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein (PubMed:19692335). Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation. Neuronal receptor for LGI1.4 Publications

GO - Molecular functioni

  • integrin binding Source: UniProtKB
  • metalloendopeptidase activity Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-HSA-5682910 LGI-ADAM interactions

Protein family/group databases

MEROPSiM12.978

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Alternative name(s):
Metalloproteinase-disintegrin ADAM22-3
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Gene namesi
Name:ADAM22
Synonyms:MDC2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000008277.14
HGNCiHGNC:201 ADAM22
MIMi603709 gene
neXtProtiNX_Q9P0K1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini223 – 736ExtracellularSequence analysisAdd BLAST514
Transmembranei737 – 757HelicalSequence analysisAdd BLAST21
Topological domaini758 – 906CytoplasmicSequence analysisAdd BLAST149

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Involvement in diseasei

Epileptic encephalopathy, early infantile, 61 (EIEE61)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. EIEE61 is an autosomal recessive condition characterized by onset of seizures in infancy.
See also OMIM:617933
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_080496401C → Y in EIEE61; unknown pathological significance; loss of interaction with LGI1; no effect on DLG4-binding, nor on subcellular location. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi834S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-857. 2 Publications1
Mutagenesisi857S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-834. 2 Publications1

Keywords - Diseasei

Disease mutation, Epilepsy

Organism-specific databases

DisGeNETi53616
MalaCardsiADAM22
MIMi617933 phenotype
OpenTargetsiENSG00000008277
PharmGKBiPA24518

Polymorphism and mutation databases

BioMutaiADAM22
DMDMi14423634

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
PropeptideiPRO_000002911226 – 222By similarityAdd BLAST197
ChainiPRO_0000029113223 – 906Disintegrin and metalloproteinase domain-containing protein 22Add BLAST684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi175N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi349 ↔ 4331 Publication
Disulfide bondi392 ↔ 4171 Publication
Disulfide bondi394 ↔ 4011 Publication
Disulfide bondi447 ↔ 4771 Publication
Disulfide bondi458 ↔ 4741 Publication
Disulfide bondi460 ↔ 4661 Publication
Disulfide bondi473 ↔ 4941 Publication
Disulfide bondi485 ↔ 4911 Publication
Disulfide bondi490 ↔ 5161 Publication
Disulfide bondi503 ↔ 5231 Publication
Disulfide bondi510 ↔ 5421 Publication
Glycosylationi519N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi535 ↔ 5471 Publication
Disulfide bondi554 ↔ 6051 Publication
Disulfide bondi569 ↔ 6351 Publication
Disulfide bondi583 ↔ 5931 Publication
Disulfide bondi600 ↔ 6631 Publication
Glycosylationi634N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi657 ↔ 6681 Publication
Glycosylationi675N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi679 ↔ 6941 Publication
Disulfide bondi688 ↔ 7001 Publication
Disulfide bondi702 ↔ 7111 Publication
Modified residuei810PhosphoserineBy similarity1
Modified residuei834PhosphoserineCombined sources1
Modified residuei857PhosphoserineBy similarity1
Modified residuei862PhosphoserineBy similarity1
Modified residuei866PhosphoserineBy similarity1
Modified residuei870PhosphoserineBy similarity1

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9P0K1
PaxDbiQ9P0K1
PeptideAtlasiQ9P0K1
PRIDEiQ9P0K1
ProteomicsDBi83556
83557 [Q9P0K1-2]
83558 [Q9P0K1-3]
83559 [Q9P0K1-4]
83560 [Q9P0K1-5]

PTM databases

iPTMnetiQ9P0K1
PhosphoSitePlusiQ9P0K1

Expressioni

Tissue specificityi

Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues.1 Publication

Gene expression databases

BgeeiENSG00000008277 Expressed in 169 organ(s), highest expression level in cerebellum
CleanExiHS_ADAM22
ExpressionAtlasiQ9P0K1 baseline and differential
GenevisibleiQ9P0K1 HS

Organism-specific databases

HPAiHPA050325

Interactioni

Subunit structurei

Interacts with LGI1 (PubMed:27066583). Interacts with DLG4/PSD95 (PubMed:27066583). Also binds LGI4 (By similarity). Interacts with KCNA2 and DLG2 (By similarity). Interacts (via C-terminus) with YWHAB/14-3-3 beta and YWHAZ/14-3-3 zeta but not with YWHAE/14-3-3 epsilon or YWHAH/14-3-3 eta (PubMed:12589811, PubMed:15882968).By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119789, 13 interactors
ELMiQ9P0K1
IntActiQ9P0K1, 12 interactors
MINTiQ9P0K1
STRINGi9606.ENSP00000265727

Structurei

Secondary structure

1906
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9P0K1
SMRiQ9P0K1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P0K1

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini239 – 438Peptidase M12BPROSITE-ProRule annotationAdd BLAST200
Domaini444 – 531DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini675 – 712EGF-likeAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi532 – 678Cys-richAdd BLAST147

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3607 Eukaryota
ENOG410XX2M LUCA
GeneTreeiENSGT00910000144014
HOGENOMiHOG000231962
HOVERGENiHBG050456
InParanoidiQ9P0K1
KOiK16068
OMAiSWQGNIG
OrthoDBiEOG091G010C
PhylomeDBiQ9P0K1
TreeFamiTF314733

Family and domain databases

CDDicd04269 ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586 ADAM_Cys-rich
IPR018358 Disintegrin_CS
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR013111 EGF_extracell
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF07974 EGF_2, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit
PRINTSiPR00289 DISINTEGRIN
SMARTiView protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit
SUPFAMiSSF57552 SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS00427 DISINTEGRIN_1, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS00022 EGF_1, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9P0K1-1) [UniParc]FASTAAdd to basket
Also known as: Epsilon

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAAVAVSVP FLLLCVLGTC PPARCGQAGD ASLMELEKRK ENRFVERQSI
60 70 80 90 100
VPLRLIYRSG GEDESRHDAL DTRVRGDLGG PQLTHVDQAS FQVDAFGTSF
110 120 130 140 150
ILDVVLNHDL LSSEYIERHI EHGGKTVEVK GGEHCYYQGH IRGNPDSFVA
160 170 180 190 200
LSTCHGLHGM FYDGNHTYLI EPEENDTTQE DFHFHSVYKS RLFEFSLDDL
210 220 230 240 250
PSEFQQVNIT PSKFILKPRP KRSKRQLRRY PRNVEEETKY IELMIVNDHL
260 270 280 290 300
MFKKHRLSVV HTNTYAKSVV NMADLIYKDQ LKTRIVLVAM ETWATDNKFA
310 320 330 340 350
ISENPLITLR EFMKYRRDFI KEKSDAVHLF SGSQFESSRS GAAYIGGICS
360 370 380 390 400
LLKGGGVNEF GKTDLMAVTL AQSLAHNIGI ISDKRKLASG ECKCEDTWSG
410 420 430 440 450
CIMGDTGYYL PKKFTQCNIE EYHDFLNSGG GACLFNKPSK LLDPPECGNG
460 470 480 490 500
FIETGEECDC GTPAECVLEG AECCKKCTLT QDSQCSDGLC CKKCKFQPMG
510 520 530 540 550
TVCREAVNDC DIRETCSGNS SQCAPNIHKM DGYSCDGVQG ICFGGRCKTR
560 570 580 590 600
DRQCKYIWGQ KVTASDKYCY EKLNIEGTEK GNCGKDKDTW IQCNKRDVLC
610 620 630 640 650
GYLLCTNIGN IPRLGELDGE ITSTLVVQQG RTLNCSGGHV KLEEDVDLGY
660 670 680 690 700
VEDGTPCGPQ MMCLEHRCLP VASFNFSTCL SSKEGTICSG NGVCSNELKC
710 720 730 740 750
VCNRHWIGSD CNTYFPHNDD AKTGITLSGN GVAGTNIIIG IIAGTILVLA
760 770 780 790 800
LILGITAWGY KNYREQRQLP QGDYVKKPGD GDSFYSDIPP GVSTNSASSS
810 820 830 840 850
KKRSNGLSHS WSERIPDTKH ISDICENGRP RSNSWQGNLG GNKKKIRGKR
860 870 880 890 900
FRPRSNSTET LSPAKSPSSS TGSIASSRKY PYPMPPLPDE DKKVNRQSAR

LWETSI
Length:906
Mass (Da):100,433
Last modified:October 1, 2000 - v1
Checksum:i265ECCD0FA6C088B
GO
Isoform 2 (identifier: Q9P0K1-2) [UniParc]FASTAAdd to basket
Also known as: Delta

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.
     859-859: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:899
Mass (Da):100,269
Checksum:i5AB89C258ECE0736
GO
Isoform 3 (identifier: Q9P0K1-3) [UniParc]FASTAAdd to basket
Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     860-906: Missing.

Show »
Length:859
Mass (Da):95,288
Checksum:i6105B681A1331D55
GO
Isoform 4 (identifier: Q9P0K1-4) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.
     860-906: Missing.

Show »
Length:823
Mass (Da):91,492
Checksum:iE9FD1A9BA99DE0DB
GO
Isoform 5 (identifier: Q9P0K1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.

Show »
Length:870
Mass (Da):96,637
Checksum:iC236086AD0BCCA2F
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WAD8F8WAD8_HUMAN
Disintegrin and metalloproteinase d...
ADAM22
804Annotation score:
E7EPF1E7EPF1_HUMAN
Disintegrin and metalloproteinase d...
ADAM22
342Annotation score:
H7C0Q9H7C0Q9_HUMAN
Disintegrin and metalloproteinase d...
ADAM22
330Annotation score:
H7C3I4H7C3I4_HUMAN
Disintegrin and metalloproteinase d...
ADAM22
264Annotation score:
E9PF78E9PF78_HUMAN
Disintegrin and metalloproteinase d...
ADAM22
196Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q9P0K1-2)
Sequence conflicti848G → E in AAF73288 (PubMed:11050470).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02005781P → R2 PublicationsCorresponds to variant dbSNP:rs2279542Ensembl.1
Natural variantiVAR_051589119H → Y. Corresponds to variant dbSNP:rs4728730Ensembl.1
Natural variantiVAR_051590207V → I. Corresponds to variant dbSNP:rs17255978Ensembl.1
Natural variantiVAR_080496401C → Y in EIEE61; unknown pathological significance; loss of interaction with LGI1; no effect on DLG4-binding, nor on subcellular location. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005482768 – 803Missing in isoform 2, isoform 4 and isoform 5. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_005484859E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 2. 1 Publication1
Alternative sequenceiVSP_005483860 – 906Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009671 mRNA Translation: BAA32349.1
AB009671 mRNA Translation: BAA32350.1
AF155381 mRNA Translation: AAF73288.1
AF155382 mRNA Translation: AAF73289.1
AF073291 mRNA Translation: AAF22476.2
AC005075 Genomic DNA No translation available.
AF158637 mRNA Translation: AAD55251.1
CCDSiCCDS43608.1 [Q9P0K1-2]
CCDS43609.1 [Q9P0K1-5]
CCDS43610.1 [Q9P0K1-3]
CCDS47637.1 [Q9P0K1-1]
RefSeqiNP_004185.1, NM_004194.4 [Q9P0K1-3]
NP_068367.1, NM_021721.4 [Q9P0K1-4]
NP_068368.2, NM_021722.5 [Q9P0K1-2]
NP_068369.1, NM_021723.4 [Q9P0K1-1]
UniGeneiHs.256398

Genome annotation databases

EnsembliENST00000265727; ENSP00000265727; ENSG00000008277 [Q9P0K1-1]
ENST00000398201; ENSP00000381260; ENSG00000008277 [Q9P0K1-3]
ENST00000398204; ENSP00000381262; ENSG00000008277 [Q9P0K1-5]
ENST00000398209; ENSP00000381267; ENSG00000008277 [Q9P0K1-2]
GeneIDi53616
KEGGihsa:53616
UCSCiuc003ujk.3 human [Q9P0K1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009671 mRNA Translation: BAA32349.1
AB009671 mRNA Translation: BAA32350.1
AF155381 mRNA Translation: AAF73288.1
AF155382 mRNA Translation: AAF73289.1
AF073291 mRNA Translation: AAF22476.2
AC005075 Genomic DNA No translation available.
AF158637 mRNA Translation: AAD55251.1
CCDSiCCDS43608.1 [Q9P0K1-2]
CCDS43609.1 [Q9P0K1-5]
CCDS43610.1 [Q9P0K1-3]
CCDS47637.1 [Q9P0K1-1]
RefSeqiNP_004185.1, NM_004194.4 [Q9P0K1-3]
NP_068367.1, NM_021721.4 [Q9P0K1-4]
NP_068368.2, NM_021722.5 [Q9P0K1-2]
NP_068369.1, NM_021723.4 [Q9P0K1-1]
UniGeneiHs.256398

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3G5CX-ray2.36A/B233-736[»]
5Y2ZX-ray2.67A/C/E/G/I/K233-729[»]
5Y31X-ray7.12A/C233-729[»]
ProteinModelPortaliQ9P0K1
SMRiQ9P0K1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119789, 13 interactors
ELMiQ9P0K1
IntActiQ9P0K1, 12 interactors
MINTiQ9P0K1
STRINGi9606.ENSP00000265727

Protein family/group databases

MEROPSiM12.978

PTM databases

iPTMnetiQ9P0K1
PhosphoSitePlusiQ9P0K1

Polymorphism and mutation databases

BioMutaiADAM22
DMDMi14423634

Proteomic databases

MaxQBiQ9P0K1
PaxDbiQ9P0K1
PeptideAtlasiQ9P0K1
PRIDEiQ9P0K1
ProteomicsDBi83556
83557 [Q9P0K1-2]
83558 [Q9P0K1-3]
83559 [Q9P0K1-4]
83560 [Q9P0K1-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265727; ENSP00000265727; ENSG00000008277 [Q9P0K1-1]
ENST00000398201; ENSP00000381260; ENSG00000008277 [Q9P0K1-3]
ENST00000398204; ENSP00000381262; ENSG00000008277 [Q9P0K1-5]
ENST00000398209; ENSP00000381267; ENSG00000008277 [Q9P0K1-2]
GeneIDi53616
KEGGihsa:53616
UCSCiuc003ujk.3 human [Q9P0K1-1]

Organism-specific databases

CTDi53616
DisGeNETi53616
EuPathDBiHostDB:ENSG00000008277.14
GeneCardsiADAM22
HGNCiHGNC:201 ADAM22
HPAiHPA050325
MalaCardsiADAM22
MIMi603709 gene
617933 phenotype
neXtProtiNX_Q9P0K1
OpenTargetsiENSG00000008277
PharmGKBiPA24518
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3607 Eukaryota
ENOG410XX2M LUCA
GeneTreeiENSGT00910000144014
HOGENOMiHOG000231962
HOVERGENiHBG050456
InParanoidiQ9P0K1
KOiK16068
OMAiSWQGNIG
OrthoDBiEOG091G010C
PhylomeDBiQ9P0K1
TreeFamiTF314733

Enzyme and pathway databases

ReactomeiR-HSA-5682910 LGI-ADAM interactions

Miscellaneous databases

ChiTaRSiADAM22 human
EvolutionaryTraceiQ9P0K1
GeneWikiiADAM22
GenomeRNAii53616
PROiPR:Q9P0K1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000008277 Expressed in 169 organ(s), highest expression level in cerebellum
CleanExiHS_ADAM22
ExpressionAtlasiQ9P0K1 baseline and differential
GenevisibleiQ9P0K1 HS

Family and domain databases

CDDicd04269 ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586 ADAM_Cys-rich
IPR018358 Disintegrin_CS
IPR001762 Disintegrin_dom
IPR036436 Disintegrin_dom_sf
IPR013032 EGF-like_CS
IPR013111 EGF_extracell
IPR024079 MetalloPept_cat_dom_sf
IPR001590 Peptidase_M12B
IPR002870 Peptidase_M12B_N
IPR034027 Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516 ADAM_CR, 1 hit
PF00200 Disintegrin, 1 hit
PF07974 EGF_2, 1 hit
PF01562 Pep_M12B_propep, 1 hit
PF01421 Reprolysin, 1 hit
PRINTSiPR00289 DISINTEGRIN
SMARTiView protein in SMART
SM00608 ACR, 1 hit
SM00050 DISIN, 1 hit
SUPFAMiSSF57552 SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215 ADAM_MEPRO, 1 hit
PS00427 DISINTEGRIN_1, 1 hit
PS50214 DISINTEGRIN_2, 1 hit
PS00022 EGF_1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiADA22_HUMAN
AccessioniPrimary (citable) accession number: Q9P0K1
Secondary accession number(s): O75075
, O75076, Q9P0K2, Q9UIA1, Q9UKK2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 176 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again