Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thymocyte nuclear protein 1

Gene

THYN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Thymocyte nuclear protein 1
Alternative name(s):
Thymocyte protein Thy28
Gene namesi
Name:THYN1
Synonyms:THY28
ORF Names:HSPC144, MDS012, My0054
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000151500.14
HGNCiHGNC:29560 THYN1
MIMi613739 gene
neXtProtiNX_Q9P016

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi29087
OpenTargetsiENSG00000151500
PharmGKBiPA128394653

Polymorphism and mutation databases

BioMutaiTHYN1
DMDMi74734762

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002625641 – 225Thymocyte nuclear protein 1Add BLAST225

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P016
MaxQBiQ9P016
PaxDbiQ9P016
PeptideAtlasiQ9P016
PRIDEiQ9P016
ProteomicsDBi83534
83535 [Q9P016-2]

PTM databases

iPTMnetiQ9P016
PhosphoSitePlusiQ9P016

Expressioni

Gene expression databases

BgeeiENSG00000151500 Expressed in 227 organ(s), highest expression level in oocyte
CleanExiHS_THYN1
ExpressionAtlasiQ9P016 baseline and differential
GenevisibleiQ9P016 HS

Organism-specific databases

HPAiHPA038732
HPA038733

Interactioni

Protein-protein interaction databases

BioGridi118856, 10 interactors
IntActiQ9P016, 2 interactors
MINTiQ9P016
STRINGi9606.ENSP00000341657

Structurei

Secondary structure

1225
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9P016
SMRiQ9P016
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P016

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi5 – 10Nuclear localization signalBy similarity6

Phylogenomic databases

eggNOGiKOG3383 Eukaryota
COG2947 LUCA
GeneTreeiENSGT00390000013297
HOGENOMiHOG000263533
HOVERGENiHBG054408
InParanoidiQ9P016
OMAiGPLKNMA
OrthoDBiEOG091G0MPN
PhylomeDBiQ9P016
TreeFamiTF332126

Family and domain databases

InterProiView protein in InterPro
IPR002740 EVE_domain
IPR015947 PUA-like_sf
PfamiView protein in Pfam
PF01878 EVE, 1 hit
SUPFAMiSSF88697 SSF88697, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9P016-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRPRKRLAG TSGSDKGLSG KRTKTENSGE ALAKVEDSNP QKTSATKNCL
60 70 80 90 100
KNLSSHWLMK SEPESRLEKG VDVKFSIEDL KAQPKQTTCW DGVRNYQARN
110 120 130 140 150
FLRAMKLGEE AFFYHSNCKE PGIAGLMKIV KEAYPDHTQF EKNNPHYDPS
160 170 180 190 200
SKEDNPKWSM VDVQFVRMMK RFIPLAELKS YHQAHKATGG PLKNMVLFTR
210 220
QRLSIQPLTQ EEFDFVLSLE EKEPS
Length:225
Mass (Da):25,697
Last modified:October 1, 2000 - v1
Checksum:i76E6034A6404C962
GO
Isoform 2 (identifier: Q9P016-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-225: VDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS → KSLILF

Show »
Length:166
Mass (Da):18,812
Checksum:i444349B36A982256
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29G → V in AAH93074 (PubMed:15489334).Curated1
Sequence conflicti223E → G in AAG43118 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021789161 – 225VDVQF…EKEPS → KSLILF in isoform 2. 2 PublicationsAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087886 mRNA Translation: AAP97185.1
AF059619 mRNA Translation: AAG43118.1
AF182413 mRNA Translation: AAG14949.1
AF161493 mRNA Translation: AAF29108.1
BC006978 mRNA Translation: AAH06978.1
BC093074 mRNA Translation: AAH93074.1
CCDSiCCDS8496.1 [Q9P016-1]
CCDS8497.1 [Q9P016-2]
RefSeqiNP_001032381.1, NM_001037304.1 [Q9P016-2]
NP_001032382.1, NM_001037305.1 [Q9P016-1]
NP_054893.1, NM_014174.2 [Q9P016-1]
NP_954994.1, NM_199297.1 [Q9P016-2]
NP_954995.1, NM_199298.1 [Q9P016-1]
UniGeneiHs.13645

Genome annotation databases

EnsembliENST00000341541; ENSP00000341657; ENSG00000151500 [Q9P016-1]
ENST00000352327; ENSP00000341452; ENSG00000151500 [Q9P016-2]
ENST00000392594; ENSP00000376373; ENSG00000151500 [Q9P016-1]
ENST00000392595; ENSP00000376374; ENSG00000151500 [Q9P016-1]
GeneIDi29087
KEGGihsa:29087
UCSCiuc001qhf.4 human [Q9P016-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087886 mRNA Translation: AAP97185.1
AF059619 mRNA Translation: AAG43118.1
AF182413 mRNA Translation: AAG14949.1
AF161493 mRNA Translation: AAF29108.1
BC006978 mRNA Translation: AAH06978.1
BC093074 mRNA Translation: AAH93074.1
CCDSiCCDS8496.1 [Q9P016-1]
CCDS8497.1 [Q9P016-2]
RefSeqiNP_001032381.1, NM_001037304.1 [Q9P016-2]
NP_001032382.1, NM_001037305.1 [Q9P016-1]
NP_054893.1, NM_014174.2 [Q9P016-1]
NP_954994.1, NM_199297.1 [Q9P016-2]
NP_954995.1, NM_199298.1 [Q9P016-1]
UniGeneiHs.13645

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EOPX-ray2.30A/B55-221[»]
5J3EX-ray2.60A/B1-225[»]
ProteinModelPortaliQ9P016
SMRiQ9P016
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118856, 10 interactors
IntActiQ9P016, 2 interactors
MINTiQ9P016
STRINGi9606.ENSP00000341657

PTM databases

iPTMnetiQ9P016
PhosphoSitePlusiQ9P016

Polymorphism and mutation databases

BioMutaiTHYN1
DMDMi74734762

Proteomic databases

EPDiQ9P016
MaxQBiQ9P016
PaxDbiQ9P016
PeptideAtlasiQ9P016
PRIDEiQ9P016
ProteomicsDBi83534
83535 [Q9P016-2]

Protocols and materials databases

DNASUi29087
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341541; ENSP00000341657; ENSG00000151500 [Q9P016-1]
ENST00000352327; ENSP00000341452; ENSG00000151500 [Q9P016-2]
ENST00000392594; ENSP00000376373; ENSG00000151500 [Q9P016-1]
ENST00000392595; ENSP00000376374; ENSG00000151500 [Q9P016-1]
GeneIDi29087
KEGGihsa:29087
UCSCiuc001qhf.4 human [Q9P016-1]

Organism-specific databases

CTDi29087
DisGeNETi29087
EuPathDBiHostDB:ENSG00000151500.14
GeneCardsiTHYN1
HGNCiHGNC:29560 THYN1
HPAiHPA038732
HPA038733
MIMi613739 gene
neXtProtiNX_Q9P016
OpenTargetsiENSG00000151500
PharmGKBiPA128394653
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3383 Eukaryota
COG2947 LUCA
GeneTreeiENSGT00390000013297
HOGENOMiHOG000263533
HOVERGENiHBG054408
InParanoidiQ9P016
OMAiGPLKNMA
OrthoDBiEOG091G0MPN
PhylomeDBiQ9P016
TreeFamiTF332126

Miscellaneous databases

EvolutionaryTraceiQ9P016
GeneWikiiTHYN1
GenomeRNAii29087
PROiPR:Q9P016
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151500 Expressed in 227 organ(s), highest expression level in oocyte
CleanExiHS_THYN1
ExpressionAtlasiQ9P016 baseline and differential
GenevisibleiQ9P016 HS

Family and domain databases

InterProiView protein in InterPro
IPR002740 EVE_domain
IPR015947 PUA-like_sf
PfamiView protein in Pfam
PF01878 EVE, 1 hit
SUPFAMiSSF88697 SSF88697, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTHYN1_HUMAN
AccessioniPrimary (citable) accession number: Q9P016
Secondary accession number(s): Q567Q2, Q9H3L4, Q9HC20
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: October 1, 2000
Last modified: September 12, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again