Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZZ3 (CHMP5_HUMAN)

Entry version 170 (07 Apr 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Charged multivesicular body protein 5

Gene

CHMP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NZZ3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-162588, Budding and maturation of HIV virion
R-HSA-917729, Endosomal Sorting Complex Required For Transport (ESCRT)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Charged multivesicular body protein 5
Alternative name(s):
Chromatin-modifying protein 5
SNF7 domain-containing protein 2
Vacuolar protein sorting-associated protein 60
Short name:
Vps60
Short name:
hVps60
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHMP5
Synonyms:C9orf83, SNF7DC2
ORF Names:CGI-34, HSPC177, PNAS-114, PNAS-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26942, CHMP5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610900, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZZ3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000086065.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		51510

Open Targets

More...OpenTargetsi		ENSG00000086065

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134903143

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NZZ3, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CHMP5

Domain mapping of disease mutations (DMDM)

More...DMDMi		51702157

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002115001 – 219Charged multivesicular body protein 5Add BLAST219

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei86PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

ISGylated. Isgylation inhibits its interaction with VTA1.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NZZ3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NZZ3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NZZ3

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NZZ3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZZ3

PeptideAtlas

More...PeptideAtlasi		Q9NZZ3

PRoteomics IDEntifications database

More...PRIDEi		Q9NZZ3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83526 [Q9NZZ3-1]
83527 [Q9NZZ3-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9NZZ3-1 [Q9NZZ3-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NZZ3

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9NZZ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NZZ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by muramyl-dipeptide and lipopolysaccharide.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000086065, Expressed in caudate nucleus and 244 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZZ3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000086065, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentially.

Interacts with VTA1.

Interacts with CHMP2A.

Interacts with VTA1; the interaction involves soluble CHMP5.

Interacts with NOD2 (PubMed:27812135).

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119579, 60 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-329, ESCRT-III complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9NZZ3

Database of interacting proteins

More...DIPi		DIP-50420N

Protein interaction database and analysis system

More...IntActi		Q9NZZ3, 45 interactors

Molecular INTeraction database

More...MINTi		Q9NZZ3

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000223500

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NZZ3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1219
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9NZZ3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZZ3

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni121 – 158Interaction with VTA1Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili26 – 179Sequence analysisAdd BLAST154

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1655, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00550000074817

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_079409_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZZ3

Identification of Orthologs from Complete Genome Data

More...OMAi		TQQTFNM

Database of Orthologous Groups

More...OrthoDBi		1301560at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZZ3

TreeFam database of animal gene trees

More...TreeFami		TF300122

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005024, Snf7_fam

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03357, Snf7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NZZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRLFGKAKP KAPPPSLTDC IGTVDSRAES IDKKISRLDA ELVKYKDQIK 
        60         70         80         90        100
KMREGPAKNM VKQKALRVLK QKRMYEQQRD NLAQQSFNME QANYTIQSLK 
       110        120        130        140        150
DTKTTVDAMK LGVKEMKKAY KQVKIDQIED LQDQLEDMME DANEIQEALS 
       160        170        180        190        200
RSYGTPELDE DDLEAELDAL GDELLADEDS SYLDEAASAP AIPEGVPTDT 
       210 
KNKDGVLVDE FGLPQIPAS
Length:219
Mass (Da):24,571
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC99695F66FD7E126
GO
Isoform 2 (identifier: Q9NZZ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-219: ELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS → GWSSGG

Show »
Length:171
Mass (Da):19,520
Checksum:iA4986DBBA8926742
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG23821 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14P → R in AAD27743 (PubMed:10810093).Curated1
Sequence conflicti19D → G in AAH16698 (PubMed:15489334).Curated1
Sequence conflicti84 – 93QQSFNMEQAN → NSHSTWTGH in AAD27743 (PubMed:10810093).Curated10
Sequence conflicti122Q → P in AAD27743 (PubMed:10810093).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042556166 – 219ELDAL…QIPAS → GWSSGG in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF132968 mRNA Translation: AAD27743.1
AF161525 mRNA Translation: AAF29140.1
AK295744 mRNA Translation: BAG58578.1
AK315455 mRNA Translation: BAG37842.1
AL356472 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58512.1
BC006974 mRNA Translation: AAH06974.1
BC007457 mRNA Translation: AAH07457.1
BC016698 mRNA Translation: AAH16698.1
BC020796 mRNA Translation: AAH20796.1
BC021168 mRNA Translation: AAH21168.1
AF275810 mRNA Translation: AAG23821.1 Different initiation.
AF229832 mRNA Translation: AAF42917.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS56569.1 [Q9NZZ3-2]
CCDS6537.1 [Q9NZZ3-1]

NCBI Reference Sequences

More...RefSeqi		NP_001182465.1, NM_001195536.1 [Q9NZZ3-2]
NP_057494.3, NM_016410.5 [Q9NZZ3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000223500; ENSP00000223500; ENSG00000086065 [Q9NZZ3-1]
ENST00000419016; ENSP00000442725; ENSG00000086065 [Q9NZZ3-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51510

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51510

UCSC genome browser

More...UCSCi		uc003zsm.5, human [Q9NZZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132968 mRNA Translation: AAD27743.1
AF161525 mRNA Translation: AAF29140.1
AK295744 mRNA Translation: BAG58578.1
AK315455 mRNA Translation: BAG37842.1
AL356472 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58512.1
BC006974 mRNA Translation: AAH06974.1
BC007457 mRNA Translation: AAH07457.1
BC016698 mRNA Translation: AAH16698.1
BC020796 mRNA Translation: AAH20796.1
BC021168 mRNA Translation: AAH21168.1
AF275810 mRNA Translation: AAG23821.1 Different initiation.
AF229832 mRNA Translation: AAF42917.1
CCDSiCCDS56569.1 [Q9NZZ3-2]
CCDS6537.1 [Q9NZZ3-1]
RefSeqiNP_001182465.1, NM_001195536.1 [Q9NZZ3-2]
NP_057494.3, NM_016410.5 [Q9NZZ3-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LXMNMR-B139-195[»]
3ULYX-ray2.60B151-219[»]
3UM0X-ray3.10B200-219[»]
3UM1X-ray2.71B/E151-219[»]
3UM2X-ray2.59B/E200-219[»]
4TXRX-ray1.00C139-195[»]
BMRBiQ9NZZ3
SMRiQ9NZZ3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119579, 60 interactors
ComplexPortaliCPX-329, ESCRT-III complex
CORUMiQ9NZZ3
DIPiDIP-50420N
IntActiQ9NZZ3, 45 interactors
MINTiQ9NZZ3
STRINGi9606.ENSP00000223500

PTM databases

iPTMnetiQ9NZZ3
MetOSiteiQ9NZZ3
PhosphoSitePlusiQ9NZZ3

Genetic variation databases

BioMutaiCHMP5
DMDMi51702157

Proteomic databases

EPDiQ9NZZ3
jPOSTiQ9NZZ3
MassIVEiQ9NZZ3
MaxQBiQ9NZZ3
PaxDbiQ9NZZ3
PeptideAtlasiQ9NZZ3
PRIDEiQ9NZZ3
ProteomicsDBi83526 [Q9NZZ3-1]
83527 [Q9NZZ3-2]
TopDownProteomicsiQ9NZZ3-1 [Q9NZZ3-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25186, 228 antibodies

The DNASU plasmid repository

More...DNASUi		51510

Genome annotation databases

EnsembliENST00000223500; ENSP00000223500; ENSG00000086065 [Q9NZZ3-1]
ENST00000419016; ENSP00000442725; ENSG00000086065 [Q9NZZ3-2]
GeneIDi51510
KEGGihsa:51510
UCSCiuc003zsm.5, human [Q9NZZ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51510
DisGeNETi51510

GeneCards: human genes, protein and diseases

More...GeneCardsi		CHMP5
HGNCiHGNC:26942, CHMP5
HPAiENSG00000086065, Low tissue specificity
MIMi610900, gene
neXtProtiNX_Q9NZZ3
OpenTargetsiENSG00000086065
PharmGKBiPA134903143
VEuPathDBiHostDB:ENSG00000086065.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1655, Eukaryota
GeneTreeiENSGT00550000074817
HOGENOMiCLU_079409_0_0_1
InParanoidiQ9NZZ3
OMAiTQQTFNM
OrthoDBi1301560at2759
PhylomeDBiQ9NZZ3
TreeFamiTF300122

Enzyme and pathway databases

PathwayCommonsiQ9NZZ3
ReactomeiR-HSA-162588, Budding and maturation of HIV virion
R-HSA-917729, Endosomal Sorting Complex Required For Transport (ESCRT)

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		51510, 448 hits in 968 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CHMP5, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CHMP5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51510
PharosiQ9NZZ3, Tbio

Protein Ontology

More...PROi		PR:Q9NZZ3
RNActiQ9NZZ3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000086065, Expressed in caudate nucleus and 244 other tissues
GenevisibleiQ9NZZ3, HS

Family and domain databases

InterProiView protein in InterPro
IPR005024, Snf7_fam
PfamiView protein in Pfam
PF03357, Snf7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHMP5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZZ3
Secondary accession number(s): B2RD95
, B4DIR6, Q5VXW2, Q96AV2, Q9HB68, Q9NYS4, Q9Y323
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: October 1, 2000
Last modified: April 7, 2021
This is version 170 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again