Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Charged multivesicular body protein 5

Gene

CHMP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cell separation after cytokinesis Source: UniProtKB
  • endosome to lysosome transport Source: Ensembl
  • ESCRT III complex disassembly Source: ParkinsonsUK-UCL
  • lysosome organization Source: Ensembl
  • mitotic metaphase plate congression Source: UniProtKB
  • multivesicular body assembly Source: ParkinsonsUK-UCL
  • multivesicular body sorting pathway Source: UniProtKB
  • nucleus organization Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • regulation of centrosome duplication Source: UniProtKB
  • regulation of mitotic spindle assembly Source: UniProtKB
  • regulation of receptor recycling Source: Ensembl
  • viral budding Source: UniProtKB
  • viral life cycle Source: Reactome

Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-162588 Budding and maturation of HIV virion
R-HSA-917729 Endosomal Sorting Complex Required For Transport (ESCRT)

Names & Taxonomyi

Protein namesi
Recommended name:
Charged multivesicular body protein 5
Alternative name(s):
Chromatin-modifying protein 5
SNF7 domain-containing protein 2
Vacuolar protein sorting-associated protein 60
Short name:
Vps60
Short name:
hVps60
Gene namesi
Name:CHMP5
Synonyms:C9orf83, SNF7DC2
ORF Names:CGI-34, HSPC177, PNAS-114, PNAS-2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000086065.13
HGNCiHGNC:26942 CHMP5
MIMi610900 gene
neXtProtiNX_Q9NZZ3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51510
OpenTargetsiENSG00000086065
PharmGKBiPA134903143

Polymorphism and mutation databases

BioMutaiCHMP5
DMDMi51702157

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002115001 – 219Charged multivesicular body protein 5Add BLAST219

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei86PhosphoserineCombined sources1

Post-translational modificationi

ISGylated. Isgylation inhibits its interaction with VTA1.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9NZZ3
MaxQBiQ9NZZ3
PaxDbiQ9NZZ3
PeptideAtlasiQ9NZZ3
PRIDEiQ9NZZ3
ProteomicsDBi83526
83527 [Q9NZZ3-2]
TopDownProteomicsiQ9NZZ3-1 [Q9NZZ3-1]

PTM databases

iPTMnetiQ9NZZ3
PhosphoSitePlusiQ9NZZ3

Expressioni

Gene expression databases

BgeeiENSG00000086065
CleanExiHS_CHMP5
GenevisibleiQ9NZZ3 HS

Organism-specific databases

HPAiCAB033874
HPA042883
HPA056437

Interactioni

Subunit structurei

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentially. Interacts with VTA1. Interacts with CHMP2A. Interacts with VTA1; the interaction involves soluble CHMP5.4 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119579, 51 interactors
ComplexPortaliCPX-329 ESCRT-III complex
CORUMiQ9NZZ3
DIPiDIP-50420N
IntActiQ9NZZ3, 36 interactors
MINTiQ9NZZ3
STRINGi9606.ENSP00000223500

Structurei

Secondary structure

1219
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi160 – 175Combined sources16
Helixi182 – 188Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LXMNMR-B139-195[»]
3ULYX-ray2.60B151-219[»]
3UM0X-ray3.10B200-219[»]
3UM1X-ray2.71B/E151-219[»]
3UM2X-ray2.59B/E200-219[»]
4TXRX-ray1.00C139-195[»]
ProteinModelPortaliQ9NZZ3
SMRiQ9NZZ3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni121 – 158Interaction with VTA1Add BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili26 – 179Sequence analysisAdd BLAST154

Sequence similaritiesi

Belongs to the SNF7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG1655 Eukaryota
ENOG410XPDA LUCA
GeneTreeiENSGT00550000074817
HOGENOMiHOG000191086
HOVERGENiHBG055759
InParanoidiQ9NZZ3
KOiK12198
OMAiAKMRDGP
OrthoDBiEOG091G0LIN
PhylomeDBiQ9NZZ3
TreeFamiTF300122

Family and domain databases

InterProiView protein in InterPro
IPR005024 Snf7_fam
PfamiView protein in Pfam
PF03357 Snf7, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRLFGKAKP KAPPPSLTDC IGTVDSRAES IDKKISRLDA ELVKYKDQIK
60 70 80 90 100
KMREGPAKNM VKQKALRVLK QKRMYEQQRD NLAQQSFNME QANYTIQSLK
110 120 130 140 150
DTKTTVDAMK LGVKEMKKAY KQVKIDQIED LQDQLEDMME DANEIQEALS
160 170 180 190 200
RSYGTPELDE DDLEAELDAL GDELLADEDS SYLDEAASAP AIPEGVPTDT
210
KNKDGVLVDE FGLPQIPAS
Length:219
Mass (Da):24,571
Last modified:October 1, 2000 - v1
Checksum:iC99695F66FD7E126
GO
Isoform 2 (identifier: Q9NZZ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-219: ELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS → GWSSGG

Note: No experimental confirmation available.
Show »
Length:171
Mass (Da):19,520
Checksum:iA4986DBBA8926742
GO

Sequence cautioni

The sequence AAG23821 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14P → R in AAD27743 (PubMed:10810093).Curated1
Sequence conflicti19D → G in AAH16698 (PubMed:15489334).Curated1
Sequence conflicti84 – 93QQSFNMEQAN → NSHSTWTGH in AAD27743 (PubMed:10810093).Curated10
Sequence conflicti122Q → P in AAD27743 (PubMed:10810093).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042556166 – 219ELDAL…QIPAS → GWSSGG in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132968 mRNA Translation: AAD27743.1
AF161525 mRNA Translation: AAF29140.1
AK295744 mRNA Translation: BAG58578.1
AK315455 mRNA Translation: BAG37842.1
AL356472 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58512.1
BC006974 mRNA Translation: AAH06974.1
BC007457 mRNA Translation: AAH07457.1
BC016698 mRNA Translation: AAH16698.1
BC020796 mRNA Translation: AAH20796.1
BC021168 mRNA Translation: AAH21168.1
AF275810 mRNA Translation: AAG23821.1 Different initiation.
AF229832 mRNA Translation: AAF42917.1
CCDSiCCDS56569.1 [Q9NZZ3-2]
CCDS6537.1 [Q9NZZ3-1]
RefSeqiNP_001182465.1, NM_001195536.1 [Q9NZZ3-2]
NP_057494.3, NM_016410.5 [Q9NZZ3-1]
UniGeneiHs.635313

Genome annotation databases

EnsembliENST00000223500; ENSP00000223500; ENSG00000086065 [Q9NZZ3-1]
ENST00000419016; ENSP00000442725; ENSG00000086065 [Q9NZZ3-2]
GeneIDi51510
KEGGihsa:51510
UCSCiuc003zsm.5 human [Q9NZZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCHMP5_HUMAN
AccessioniPrimary (citable) accession number: Q9NZZ3
Secondary accession number(s): B2RD95
, B4DIR6, Q5VXW2, Q96AV2, Q9HB68, Q9NYS4, Q9Y323
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: October 1, 2000
Last modified: June 20, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health