CHMP5

Functionⁱ

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.1 Publication

GO - Molecular functionⁱ

cadherin binding
Source: BHF-UCL
Inferred from high throughput direct assayⁱ
- 25468996

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to lipopolysaccharide
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 27812135
cellular response to muramyl dipeptide
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 27812135
endosome to lysosome transport Source: Ensembl
ESCRT III complex disassembly
Source: ParkinsonsUK-UCL
Non-traceable author statementⁱ
- 20588296
lysosome organization Source: Ensembl
midbody abscission
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20616062
mitotic metaphase plate congression
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20616062
multivesicular body assembly
Source: ParkinsonsUK-UCL
Non-traceable author statementⁱ
- 20588296
multivesicular body sorting pathway
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 15644320
nucleus organization
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20616062
protein transport Source: UniProtKB-KW
regulation of centrosome duplication
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20616062
regulation of mitotic spindle assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20616062
regulation of receptor recycling Source: Ensembl
viral budding
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 15644320
viral life cycle Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Protein transport, Transport

Biological process

Protein transport, Transport

Enzyme and pathway databases

Reactomeⁱ	R-HSA-162588 Budding and maturation of HIV virion R-HSA-917729 Endosomal Sorting Complex Required For Transport (ESCRT)

Reactomeⁱ

R-HSA-162588 Budding and maturation of HIV virion
R-HSA-917729 Endosomal Sorting Complex Required For Transport (ESCRT)

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Charged multivesicular body protein 5 Alternative name(s): Chromatin-modifying protein 5 SNF7 domain-containing protein 2 Vacuolar protein sorting-associated protein 60 Short name: Vps60 Short name: hVps60
Gene namesⁱ	Name:CHMP5 Synonyms:C9orf83, SNF7DC2 ORF Names:CGI-34, HSPC177, PNAS-114, PNAS-2
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 9

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000086065.13
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:26942 CHMP5
MIMⁱ	610900 gene
neXtProtⁱ	NX_Q9NZZ3

Keywords - Cellular componentⁱ

Cytoplasm, Endosome, Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	51510
Open Targets More...OpenTargetsⁱ	ENSG00000086065
PharmGKBⁱ	PA134903143

Polymorphism and mutation databases

BioMutaⁱ	CHMP5
DMDMⁱ	51702157

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000211500	1 – 219	Charged multivesicular body protein 5Add BLAST		219

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	86	PhosphoserineCombined sources		1

Post-translational modificationⁱ

ISGylated. Isgylation inhibits its interaction with VTA1.1 Publication

Keywords - PTMⁱ

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	Q9NZZ3
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9NZZ3
PaxDbⁱ	Q9NZZ3
PeptideAtlas More...PeptideAtlasⁱ	Q9NZZ3
PRIDEⁱ	Q9NZZ3
ProteomicsDBⁱ	83526 83527 [Q9NZZ3-2]
TopDownProteomicsⁱ	Q9NZZ3-1 [Q9NZZ3-1]

PTM databases

iPTMnetⁱ	Q9NZZ3
PhosphoSitePlusⁱ	Q9NZZ3

Expressionⁱ

Inductionⁱ

Up-regulated by muramyl-dipeptide and lipopolysaccharide.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000086065 Expressed in 231 organ(s), highest expression level in caudate nucleus
CleanExⁱ	HS_CHMP5
Genevisibleⁱ	Q9NZZ3 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB033874 HPA042883 HPA056437

HPAⁱ

CAB033874
HPA042883
HPA056437

Interactionⁱ

Subunit structureⁱ

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentially. Interacts with VTA1. Interacts with CHMP2A. Interacts with VTA1; the interaction involves soluble CHMP5. Interacts with NOD2 (PubMed:27812135).5 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
BROX	Q5VW32	6	EBI-15979532,EBI-6286053
CHMP4B	Q9H444	4	EBI-751303,EBI-749627
MITD1	Q8WV92	3	EBI-751303,EBI-2691489
STAMBP	O95630	2	EBI-751303,EBI-396676
VPS4B	O75351	5	EBI-751303,EBI-2514459

GO - Molecular functionⁱ

cadherin binding
Source: BHF-UCL
Inferred from high throughput direct assayⁱ
- 25468996

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	119579, 52 interactors
ComplexPortalⁱ	CPX-329 ESCRT-III complex
CORUMⁱ	Q9NZZ3
Database of interacting proteins More...DIPⁱ	DIP-50420N
IntActⁱ	Q9NZZ3, 37 interactors
Molecular INTeraction database More...MINTⁱ	Q9NZZ3
STRINGⁱ	9606.ENSP00000223500

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Helixⁱ	160 – 175	Combined sources		16
Helixⁱ	182 – 188	Combined sources		7

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9NZZ3
SMRⁱ	Q9NZZ3
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	121 – 158	Interaction with VTA1Add BLAST		38

Coiled coil

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Coiled coilⁱ	26 – 179	Sequence analysisAdd BLAST		154

Sequence similaritiesⁱ

Belongs to the SNF7 family.Curated

Keywords - Domainⁱ

Coiled coil

Phylogenomic databases

eggNOGⁱ	KOG1655 Eukaryota ENOG410XPDA LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074817
HOGENOMⁱ	HOG000191086
HOVERGENⁱ	HBG055759
InParanoidⁱ	Q9NZZ3
KEGG Orthology (KO) More...KOⁱ	K12198
OMAⁱ	AKMRDGP
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0LIN
PhylomeDBⁱ	Q9NZZ3
TreeFamⁱ	TF300122

Family and domain databases

InterProⁱ	View protein in InterPro IPR005024 Snf7_fam
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03357 Snf7, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform 1 (identifier: Q9NZZ3-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRLFGKAKP KAPPPSLTDC IGTVDSRAES IDKKISRLDA ELVKYKDQIK 
        60         70         80         90        100
KMREGPAKNM VKQKALRVLK QKRMYEQQRD NLAQQSFNME QANYTIQSLK 
       110        120        130        140        150
DTKTTVDAMK LGVKEMKKAY KQVKIDQIED LQDQLEDMME DANEIQEALS 
       160        170        180        190        200
RSYGTPELDE DDLEAELDAL GDELLADEDS SYLDEAASAP AIPEGVPTDT 
       210 
KNKDGVLVDE FGLPQIPAS

Length:219

Mass (Da):24,571

Last modified:October 1, 2000 - v1

Checksum:ⁱC99695F66FD7E126

GO

Isoform 2 (identifier: Q9NZZ3-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
166-219: ELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS → GWSSGG

« Hide

        10         20         30         40         50
MNRLFGKAKP KAPPPSLTDC IGTVDSRAES IDKKISRLDA ELVKYKDQIK 
        60         70         80         90        100
KMREGPAKNM VKQKALRVLK QKRMYEQQRD NLAQQSFNME QANYTIQSLK 
       110        120        130        140        150
DTKTTVDAMK LGVKEMKKAY KQVKIDQIED LQDQLEDMME DANEIQEALS 
       160        170 
RSYGTPELDE DDLEAGWSSG G

Note: No experimental confirmation available.

Show »

Length:171

Mass (Da):19,520

Checksum:ⁱA4986DBBA8926742

GO

Sequence cautionⁱ

The sequence AAG23821 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	14	P → R in AAD27743 (PubMed:10810093).Curated	1
Sequence conflictⁱ	19	D → G in AAH16698 (PubMed:15489334).Curated	1
Sequence conflictⁱ	84 – 93	QQSFNMEQAN → NSHSTWTGH in AAD27743 (PubMed:10810093).Curated	10
Sequence conflictⁱ	122	Q → P in AAD27743 (PubMed:10810093).Curated	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_042556	166 – 219	ELDAL…QIPAS → GWSSGG in isoform 2. 1 PublicationAdd BLAST		54

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF132968 mRNA Translation: AAD27743.1 AF161525 mRNA Translation: AAF29140.1 AK295744 mRNA Translation: BAG58578.1 AK315455 mRNA Translation: BAG37842.1 AL356472 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58512.1 BC006974 mRNA Translation: AAH06974.1 BC007457 mRNA Translation: AAH07457.1 BC016698 mRNA Translation: AAH16698.1 BC020796 mRNA Translation: AAH20796.1 BC021168 mRNA Translation: AAH21168.1 AF275810 mRNA Translation: AAG23821.1 Different initiation. AF229832 mRNA Translation: AAF42917.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS56569.1 [Q9NZZ3-2] CCDS6537.1 [Q9NZZ3-1]
NCBI Reference Sequences More...RefSeqⁱ	NP_001182465.1, NM_001195536.1 [Q9NZZ3-2] NP_057494.3, NM_016410.5 [Q9NZZ3-1]
UniGeneⁱ	Hs.635313

Genome annotation databases

Ensemblⁱ	ENST00000223500; ENSP00000223500; ENSG00000086065 [Q9NZZ3-1] ENST00000419016; ENSP00000442725; ENSG00000086065 [Q9NZZ3-2]
GeneIDⁱ	51510
KEGGⁱ	hsa:51510
UCSC genome browser More...UCSCⁱ	uc003zsm.5 human [Q9NZZ3-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9NZZ3	Charged multivesicular body protein 5		PONAB		219	UniRef100_Q9NZZ3
Charged multivesicular body protein 5 isoform 1		MACMU		219
CHMP5 isoform 2		PANTR		219
Charged multivesicular body protein 5		MACFA		219
Uncharacterized protein		COLAP		219
+10
Q9NZZ3-2	CHMP5 isoform 1		PANTR		171	UniRef100_K7AN79
Uncharacterized protein		MACMU		171
Uncharacterized protein		COLAP		171
CHMP5 isoform 1		PONAB		171
Uncharacterized protein		CERAT		171
+7

Protein	Similar proteins		Species	Score	Length	Source
Q9NZZ3	Charged multivesicular body protein 5		PONAB		219	UniRef90_Q9NZZ3
Charged multivesicular body protein 5		MOUSE		219
Charged multivesicular body protein 5		RAT		219
Charged multivesicular body protein 5 isoform 1		MACMU		219
CHMP5 isoform 2		PANTR		219
+147
Q9NZZ3-2	CHMP5 isoform 1		PANTR		171	UniRef90_K7AN79
Uncharacterized protein		MACMU		171
Uncharacterized protein		COLAP		171
CHMP5 isoform 1		PONAB		171
Uncharacterized protein		CERAT		171
+16

Protein	Similar proteins		Species	Score	Length	Source
Q9NZZ3	Charged multivesicular body protein 5		PONAB		219	UniRef50_Q9NZZ3
Charged multivesicular body protein 5		MOUSE		219
Charged multivesicular body protein 5		RAT		219
Charged multivesicular body protein 5		DANRE		220
Charged multivesicular body protein 5 isoform 1		MACMU		219
+244
Q9NZZ3-2	Uncharacterized protein		PAPAN		195	UniRef50_A0A2I3MDA3
Uncharacterized protein		RHIRO		171
Uncharacterized protein		COLAP		212
Uncharacterized protein		CALJA		171
Uncharacterized protein		PROCO		171
+23

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF132968 mRNA Translation: AAD27743.1 AF161525 mRNA Translation: AAF29140.1 AK295744 mRNA Translation: BAG58578.1 AK315455 mRNA Translation: BAG37842.1 AL356472 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58512.1 BC006974 mRNA Translation: AAH06974.1 BC007457 mRNA Translation: AAH07457.1 BC016698 mRNA Translation: AAH16698.1 BC020796 mRNA Translation: AAH20796.1 BC021168 mRNA Translation: AAH21168.1 AF275810 mRNA Translation: AAG23821.1 Different initiation. AF229832 mRNA Translation: AAF42917.1
CCDSⁱ	CCDS56569.1 [Q9NZZ3-2] CCDS6537.1 [Q9NZZ3-1]
RefSeqⁱ	NP_001182465.1, NM_001195536.1 [Q9NZZ3-2] NP_057494.3, NM_016410.5 [Q9NZZ3-1]
UniGeneⁱ	Hs.635313

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2LXM	NMR	-	B	139-195	[»]
	3ULY	X-ray	2.60	B	151-219	[»]
	3UM0	X-ray	3.10	B	200-219	[»]
	3UM1	X-ray	2.71	B/E	151-219	[»]
	3UM2	X-ray	2.59	B/E	200-219	[»]
	4TXR	X-ray	1.00	C	139-195	[»]
ProteinModelPortalⁱ	Q9NZZ3
SMRⁱ	Q9NZZ3
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	119579, 52 interactors
ComplexPortalⁱ	CPX-329 ESCRT-III complex
CORUMⁱ	Q9NZZ3
DIPⁱ	DIP-50420N
IntActⁱ	Q9NZZ3, 37 interactors
MINTⁱ	Q9NZZ3
STRINGⁱ	9606.ENSP00000223500

PTM databases

iPTMnetⁱ	Q9NZZ3
PhosphoSitePlusⁱ	Q9NZZ3

Polymorphism and mutation databases

BioMutaⁱ	CHMP5
DMDMⁱ	51702157

Proteomic databases

EPDⁱ	Q9NZZ3
MaxQBⁱ	Q9NZZ3
PaxDbⁱ	Q9NZZ3
PeptideAtlasⁱ	Q9NZZ3
PRIDEⁱ	Q9NZZ3
ProteomicsDBⁱ	83526 83527 [Q9NZZ3-2]
TopDownProteomicsⁱ	Q9NZZ3-1 [Q9NZZ3-1]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	51510
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000223500; ENSP00000223500; ENSG00000086065 [Q9NZZ3-1] ENST00000419016; ENSP00000442725; ENSG00000086065 [Q9NZZ3-2]
GeneIDⁱ	51510
KEGGⁱ	hsa:51510
UCSCⁱ	uc003zsm.5 human [Q9NZZ3-1]

Organism-specific databases

CTDⁱ	51510
DisGeNETⁱ	51510
EuPathDBⁱ	HostDB:ENSG00000086065.13
GeneCardsⁱ	CHMP5
HGNCⁱ	HGNC:26942 CHMP5
HPAⁱ	CAB033874 HPA042883 HPA056437
MIMⁱ	610900 gene
neXtProtⁱ	NX_Q9NZZ3
OpenTargetsⁱ	ENSG00000086065
PharmGKBⁱ	PA134903143
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1655 Eukaryota ENOG410XPDA LUCA
GeneTreeⁱ	ENSGT00550000074817
HOGENOMⁱ	HOG000191086
HOVERGENⁱ	HBG055759
InParanoidⁱ	Q9NZZ3
KOⁱ	K12198
OMAⁱ	AKMRDGP
OrthoDBⁱ	EOG091G0LIN
PhylomeDBⁱ	Q9NZZ3
TreeFamⁱ	TF300122

Enzyme and pathway databases

Reactomeⁱ	R-HSA-162588 Budding and maturation of HIV virion R-HSA-917729 Endosomal Sorting Complex Required For Transport (ESCRT)

Reactomeⁱ

R-HSA-162588 Budding and maturation of HIV virion
R-HSA-917729 Endosomal Sorting Complex Required For Transport (ESCRT)

Miscellaneous databases

ChiTaRSⁱ	CHMP5 human
GeneWikiⁱ	CHMP5
GenomeRNAiⁱ	51510
Protein Ontology More...PROⁱ	PR:Q9NZZ3
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000086065 Expressed in 231 organ(s), highest expression level in caudate nucleus
CleanExⁱ	HS_CHMP5
Genevisibleⁱ	Q9NZZ3 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR005024 Snf7_fam
Pfamⁱ	View protein in Pfam PF03357 Snf7, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CHMP5_HUMAN
Accessionⁱ	Q9NZZ3Primary (citable) accession number: Q9NZZ3 Secondary accession number(s): B2RD95 Q9Y323
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 31, 2004
	Last sequence update:	October 1, 2000
	Last modified:	November 7, 2018
	This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 9
Human chromosome 9: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9NZZ3 (CHMP5_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Charged multivesicular body protein 5

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endosome

Cytosol

Cytosol

Endosome

Extracellular region or secreted

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Coiled coil

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ