Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (13 Feb 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

NCK-interacting protein with SH3 domain

Gene

NCKIPSD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (By similarity). May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9NZQ3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9NZQ3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NCK-interacting protein with SH3 domain
Alternative name(s):
54 kDa VacA-interacting protein
54 kDa vimentin-interacting protein
Short name:
VIP54
90 kDa SH3 protein interacting with Nck
AF3p21
Dia-interacting protein 1
Short name:
DIP-1
Diaphanous protein-interacting protein
SH3 adapter protein SPIN90
WASP-interacting SH3-domain protein
Short name:
WISH
Wiskott-Aldrich syndrome protein-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NCKIPSD
Synonyms:AF3P21, SPIN90
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000213672.7

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15486 NCKIPSD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606671 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NZQ3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei57 – 58Breakpoint for translocation to form KMT2A/MLL1-AF3P21 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
51517

Open Targets

More...
OpenTargetsi
ENSG00000213672

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134872724

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NCKIPSD

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17433253

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000721301 – 722NCK-interacting protein with SH3 domainAdd BLAST722

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei120PhosphoserineBy similarity1
Modified residuei181PhosphothreonineCombined sources1
Modified residuei294PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NZQ3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NZQ3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NZQ3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NZQ3

PeptideAtlas

More...
PeptideAtlasi
Q9NZQ3

PRoteomics IDEntifications database

More...
PRIDEi
Q9NZQ3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
83478
83479 [Q9NZQ3-2]
83480 [Q9NZQ3-3]
83481 [Q9NZQ3-4]
83482 [Q9NZQ3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NZQ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NZQ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000213672 Expressed in 212 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NZQ3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NZQ3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB019267
HPA050005

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain (By similarity). Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2.By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119583, 54 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NZQ3, 55 interactors

Molecular INTeraction database

More...
MINTi
Q9NZQ3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000294129

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1722
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6DECX-ray4.60M/P269-722[»]
6DEDX-ray2.20A/B350-722[»]
6DEEX-ray3.04A306-722[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9NZQ3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NZQ3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 58SH3PROSITE-ProRule annotationAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi175 – 192Nuclear localization signalSequence analysisAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi171 – 275Pro-richAdd BLAST105
Compositional biasi197 – 240Ser/Thr-richAdd BLAST44
Compositional biasi442 – 487Leu-richAdd BLAST46
Compositional biasi534 – 601Leu-richAdd BLAST68

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4035 Eukaryota
ENOG410Y8WT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015725

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008184

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG061630

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NZQ3

Identification of Orthologs from Complete Genome Data

More...
OMAi
METRWSI

Database of Orthologous Groups

More...
OrthoDBi
649314at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NZQ3

TreeFam database of animal gene trees

More...
TreeFami
TF324522

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11849 SH3_SPIN90, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018556 DUF2013
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035514 SPIN90_SH3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09431 DUF2013, 1 hit
PF00018 SH3_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZQ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP
60 70 80 90 100
AYLRRLQGLE QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHHR
110 120 130 140 150
KETLSRRGPS ASSVAVMTSS TSDHHLDAAA ARQPNGVCRA GFERQHSLPS
160 170 180 190 200
SEHLGADGGL YQIPLPSSQI PPQPRRAAPT TPPPPVKRRD REALMASGSG
210 220 230 240 250
GHNTMPSGGN SVSSGSSVSS TSLDTLYTSS SPSEPGSSCS PTPPPVPRRG
260 270 280 290 300
THTTVSQVQP PPSKASAPEP PAEEEVATGT TSASDDLEAL GTLSLGTTEE
310 320 330 340 350
KAAAEAAVPR TIGAELMELV RRNTGLSHEL CRVAIGIIVG HIQASVPASS
360 370 380 390 400
PVMEQVLLSL VEGKDLSMAL PSGQVCHDQQ RLEVIFADLA RRKDDAQQRS
410 420 430 440 450
WALYEDEGVI RCYLEELLHI LTDADPEVCK KMCKRNEFES VLALVAYYQM
460 470 480 490 500
EHRASLRLLL LKCFGAMCSL DAAIISTLVS SVLPVELARD MQTDTQDHQK
510 520 530 540 550
LCYSALILAM VFSMGEAVPY AHYEHLGTPF AQFLLNIVED GLPLDTTEQL
560 570 580 590 600
PDLCVNLLLA LNLHLPAADQ NVIMAALSKH ANVKIFSEKL LLLLNRGDDP
610 620 630 640 650
VRIFKHEPQP PHSVLKFLQD VFGSPATAAI FYHTDMMALI DITVRHIADL
660 670 680 690 700
SPGDKLRMEY LSLMHAIVRT TPYLQHRHRL PDLQAILRRI LNEEETSPQC
710 720
QMDRMIVREM CKEFLVLGEA PS
Length:722
Mass (Da):78,960
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7683046B94647332
GO
Isoform 2 (identifier: Q9NZQ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV

Show »
Length:722
Mass (Da):77,931
Checksum:iBFC8DE473D3C2A4B
GO
Isoform 3 (identifier: Q9NZQ3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.

Note: No experimental confirmation available.
Show »
Length:715
Mass (Da):78,237
Checksum:i73B743E6BA30F469
GO
Isoform 4 (identifier: Q9NZQ3-4) [UniParc]FASTAAdd to basket
Also known as: WISH-B

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.
     656-658: LRM → GVH
     659-722: Missing.

Show »
Length:651
Mass (Da):70,540
Checksum:i98E450E7A59047A6
GO
Isoform 5 (identifier: Q9NZQ3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC
     597-722: Missing.

Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available.
Show »
Length:596
Mass (Da):64,196
Checksum:i59BFFD741EE788F2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JSC3C9JSC3_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
395Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCR8F8WCR8_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0T9H7C0T9_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JMQ4C9JMQ4_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JC20C9JC20_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2K2H7C2K2_HUMAN
NCK-interacting protein with SH3 do...
NCKIPSD
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG57476 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051378324T → S. Corresponds to variant dbSNP:rs6785620Ensembl.1
Natural variantiVAR_063400660Y → S1 PublicationCorresponds to variant dbSNP:rs17855516Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039422165 – 171Missing in isoform 3 and isoform 4. 2 Publications7
Alternative sequenceiVSP_039423567 – 596AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_039424597 – 722Missing in isoform 5. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_003971656 – 722LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_039425656 – 658LRM → GVH in isoform 4. 1 Publication3
Alternative sequenceiVSP_039426659 – 722Missing in isoform 4. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF178432 mRNA Translation: AAF35985.1
AJ242655 mRNA Translation: CAB65089.2
AF303581 mRNA Translation: AAK09094.1
AB069981 Genomic DNA Translation: BAB63204.1
AB069982 Genomic DNA Translation: BAB63205.1
AY453794 mRNA Translation: AAR83735.1
AC141002 Genomic DNA No translation available.
BC016052 mRNA Translation: AAH16052.1
BC026280 mRNA Translation: AAH26280.1
AK294151 mRNA Translation: BAG57476.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2776.1 [Q9NZQ3-1]
CCDS46827.1 [Q9NZQ3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_057537.1, NM_016453.3 [Q9NZQ3-1]
NP_909119.1, NM_184231.2 [Q9NZQ3-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655006

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294129; ENSP00000294129; ENSG00000213672 [Q9NZQ3-1]
ENST00000416649; ENSP00000389059; ENSG00000213672 [Q9NZQ3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51517

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51517

UCSC genome browser

More...
UCSCi
uc003cum.5 human [Q9NZQ3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178432 mRNA Translation: AAF35985.1
AJ242655 mRNA Translation: CAB65089.2
AF303581 mRNA Translation: AAK09094.1
AB069981 Genomic DNA Translation: BAB63204.1
AB069982 Genomic DNA Translation: BAB63205.1
AY453794 mRNA Translation: AAR83735.1
AC141002 Genomic DNA No translation available.
BC016052 mRNA Translation: AAH16052.1
BC026280 mRNA Translation: AAH26280.1
AK294151 mRNA Translation: BAG57476.1 Different initiation.
CCDSiCCDS2776.1 [Q9NZQ3-1]
CCDS46827.1 [Q9NZQ3-3]
RefSeqiNP_057537.1, NM_016453.3 [Q9NZQ3-1]
NP_909119.1, NM_184231.2 [Q9NZQ3-3]
UniGeneiHs.655006

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6DECX-ray4.60M/P269-722[»]
6DEDX-ray2.20A/B350-722[»]
6DEEX-ray3.04A306-722[»]
ProteinModelPortaliQ9NZQ3
SMRiQ9NZQ3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119583, 54 interactors
IntActiQ9NZQ3, 55 interactors
MINTiQ9NZQ3
STRINGi9606.ENSP00000294129

PTM databases

iPTMnetiQ9NZQ3
PhosphoSitePlusiQ9NZQ3

Polymorphism and mutation databases

BioMutaiNCKIPSD
DMDMi17433253

Proteomic databases

EPDiQ9NZQ3
jPOSTiQ9NZQ3
MaxQBiQ9NZQ3
PaxDbiQ9NZQ3
PeptideAtlasiQ9NZQ3
PRIDEiQ9NZQ3
ProteomicsDBi83478
83479 [Q9NZQ3-2]
83480 [Q9NZQ3-3]
83481 [Q9NZQ3-4]
83482 [Q9NZQ3-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51517
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294129; ENSP00000294129; ENSG00000213672 [Q9NZQ3-1]
ENST00000416649; ENSP00000389059; ENSG00000213672 [Q9NZQ3-3]
GeneIDi51517
KEGGihsa:51517
UCSCiuc003cum.5 human [Q9NZQ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51517
DisGeNETi51517
EuPathDBiHostDB:ENSG00000213672.7

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NCKIPSD
HGNCiHGNC:15486 NCKIPSD
HPAiCAB019267
HPA050005
MIMi606671 gene
neXtProtiNX_Q9NZQ3
OpenTargetsiENSG00000213672
PharmGKBiPA134872724

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4035 Eukaryota
ENOG410Y8WT LUCA
GeneTreeiENSGT00390000015725
HOGENOMiHOG000008184
HOVERGENiHBG061630
InParanoidiQ9NZQ3
OMAiMETRWSI
OrthoDBi649314at2759
PhylomeDBiQ9NZQ3
TreeFamiTF324522

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SignaLinkiQ9NZQ3
SIGNORiQ9NZQ3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NCKIPSD human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NCKIPSD

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51517

Protein Ontology

More...
PROi
PR:Q9NZQ3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000213672 Expressed in 212 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiQ9NZQ3 baseline and differential
GenevisibleiQ9NZQ3 HS

Family and domain databases

CDDicd11849 SH3_SPIN90, 1 hit
InterProiView protein in InterPro
IPR018556 DUF2013
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035514 SPIN90_SH3
PfamiView protein in Pfam
PF09431 DUF2013, 1 hit
PF00018 SH3_1, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPN90_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZQ3
Secondary accession number(s): B4DFL5
, Q6GU34, Q6SPF3, Q8TC10, Q9UGM8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: October 1, 2000
Last modified: February 13, 2019
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again