Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (22 Apr 2020)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Polycystic kidney disease 2-like 2 protein

Gene

PKD2L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a subunit of a cation channel and play a role in fertilization.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel
Biological processIon transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Polycystic kidney disease 2-like 2 protein
Alternative name(s):
Polycystin-2L2
Polycystin-L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PKD2L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9012 PKD2L2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604669 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NZM6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31CytoplasmicSequence analysisAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 276ExtracellularSequence analysisAdd BLAST224
Transmembranei277 – 297HelicalSequence analysisAdd BLAST21
Topological domaini298 – 314CytoplasmicSequence analysisAdd BLAST17
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 360ExtracellularSequence analysisAdd BLAST25
Transmembranei361 – 381HelicalSequence analysisAdd BLAST21
Topological domaini382 – 406CytoplasmicSequence analysisAdd BLAST25
Transmembranei407 – 427HelicalSequence analysisAdd BLAST21
Topological domaini428 – 469ExtracellularSequence analysisAdd BLAST42
Transmembranei470 – 490HelicalSequence analysisAdd BLAST21
Topological domaini491 – 624CytoplasmicSequence analysisAdd BLAST134

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
27039

Open Targets

More...
OpenTargetsi
ENSG00000078795

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33345

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NZM6 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PKD2L2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373272

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001643611 – 624Polycystic kidney disease 2-like 2 proteinAdd BLAST624

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi115N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi138N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NZM6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NZM6

PeptideAtlas

More...
PeptideAtlasi
Q9NZM6

PRoteomics IDEntifications database

More...
PRIDEi
Q9NZM6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19398
19659
83452 [Q9NZM6-1]
83453 [Q9NZM6-2]
83454 [Q9NZM6-3]
83455 [Q9NZM6-4]
83456 [Q9NZM6-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NZM6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NZM6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

According to PubMed:10602361, expressed only in testis. According to PubMed:10756092, expressed also in brain and kidney. Isoform 2 is found only in transformed lymphoblasts. Isoform 3 is found in all tissues tested.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000078795 Expressed in tendon and 100 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NZM6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NZM6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000078795 Group enriched (blood, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117970, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NZM6, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000290431

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NZM6 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NZM6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili556 – 576Sequence analysisAdd BLAST21

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the polycystin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3599 Eukaryota
ENOG410XTGE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161122

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2995942_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NZM6

KEGG Orthology (KO)

More...
KOi
K04991

Identification of Orthologs from Complete Genome Data

More...
OMAi
NRVMRKV

Database of Orthologous Groups

More...
OrthoDBi
426073at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NZM6

TreeFam database of animal gene trees

More...
TreeFami
TF316484

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013122 PKD1_2_channel
IPR003915 PKD_2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08016 PKD_channel, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01433 POLYCYSTIN2

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZM6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEASRWHRG GASKHKLHYR KEVEITTTLQ ELLLYFIFLI NLCILTFGMV
60 70 80 90 100
NPHMYYLNKV MSSLFLDTSV PGEERTNFKS IRSITDFWKF MEGPLLEGLY
110 120 130 140 150
WDSWYNNQQL YNLKNSSRIY YENILLGVPR VRQLKVRNNT CKVYSSFQSL
160 170 180 190 200
MSECYGKYTS ANEDLSNFGL QINTEWRYST SNTNSPWHWG FLGVYRNGGY
210 220 230 240 250
IFTLSKSKSE TKNKFIDLRL NSWITRGTRV IFIDFSLYNA NVNLFCIIRL
260 270 280 290 300
VAEFPATGGI LTSWQFYSVK LLRYVSYYDY FIASCEITFC IFLFVFTTQE
310 320 330 340 350
VKKIKEFKSA YFKSIWNWLE LLLLLLCFVA VSFNTYYNVQ IFLLLGQLLK
360 370 380 390 400
STEKYSDFYF LACWHIYYNN IIAITIFFAW IKIFKFISFN KTMSQLSSTL
410 420 430 440 450
SRCVKDIVGF AIMFFIIFFA YAQLGFLVFG SQVDDFSTFQ NSIFAQFRIV
460 470 480 490 500
LGDFNFAGIQ QANPILGPIY FITFIFFVFF VLLNMFLAII NDTYSEVKAD
510 520 530 540 550
YSIGRRLDFE LGKMIKQSYK NVLEKFRLKK AQKDEDKKTK GSGDLAEQAR
560 570 580 590 600
REGFDENEIQ NAEQMKKWKE RLEKKYYSME IQDDYQPVTQ EEFRELFLYA
610 620
VELEKELHYI NLKLNQVVRK VSAL
Length:624
Mass (Da):73,790
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7D9FFA04542A47A4
GO
Isoform 2 (identifier: Q9NZM6-2) [UniParc]FASTAAdd to basket
Also known as: PKD2L2b

The sequence of this isoform differs from the canonical sequence as follows:
     11-44: Missing.
     45-45: L → V

Show »
Length:590
Mass (Da):69,746
Checksum:iBDDE4D9C3C3D7C5F
GO
Isoform 3 (identifier: Q9NZM6-3) [UniParc]FASTAAdd to basket
Also known as: PKD2L2a

The sequence of this isoform differs from the canonical sequence as follows:
     45-57: LTFGMVNPHMYYL → CYVISIFGHFCAW
     58-624: Missing.

Show »
Length:57
Mass (Da):6,759
Checksum:i4539353342C77CAA
GO
Isoform 4 (identifier: Q9NZM6-4) [UniParc]FASTAAdd to basket
Also known as: PKD2L2c

The sequence of this isoform differs from the canonical sequence as follows:
     12-23: ASKHKLHYRKEV → YVISIFGHFCAW
     24-624: Missing.

Show »
Length:23
Mass (Da):2,682
Checksum:i0C7B55E80C496CC0
GO
Isoform 5 (identifier: Q9NZM6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     595-624: ELFLYAVELEKELHYINLKLNQVVRKVSAL → DGTTTKYKMRFSECLTKRI

Show »
Length:613
Mass (Da):72,496
Checksum:i198CD4B1F9EC9804
GO
Isoform 6 (identifier: Q9NZM6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     383-483: Missing.

Show »
Length:523
Mass (Da):62,216
Checksum:i9D1CAFED503A7EF6
GO
Isoform 7 (identifier: Q9NZM6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     326-347: Missing.

Show »
Length:602
Mass (Da):71,255
Checksum:iC409FD9113F83EB1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBX8D6RBX8_HUMAN
Polycystic kidney disease 2-like 2 ...
PKD2L2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF71D6RF71_HUMAN
Polycystic kidney disease 2-like 2 ...
PKD2L2
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD46478 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti205 – 206Missing in BAG63344 (PubMed:14702039).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047542404V → I1 PublicationCorresponds to variant dbSNP:rs1880458Ensembl.1
Natural variantiVAR_047543507L → P4 PublicationsCorresponds to variant dbSNP:rs12187140Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00473211 – 44Missing in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_00473312 – 23ASKHK…YRKEV → YVISIFGHFCAW in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_00473424 – 624Missing in isoform 4. 1 PublicationAdd BLAST601
Alternative sequenceiVSP_00473645 – 57LTFGM…HMYYL → CYVISIFGHFCAW in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_00473545L → V in isoform 2. 1 Publication1
Alternative sequenceiVSP_00473758 – 624Missing in isoform 3. 1 PublicationAdd BLAST567
Alternative sequenceiVSP_045581326 – 347Missing in isoform 7. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_045582383 – 483Missing in isoform 6. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_035775595 – 624ELFLY…KVSAL → DGTTTKYKMRFSECLTKRI in isoform 5. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF118125 mRNA Translation: AAD46478.1 Frameshift.
AF182034 mRNA Translation: AAF65622.1
AC106753 Genomic DNA No translation available.
AK301924 mRNA Translation: BAG63344.1
AC106791 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62174.1
BC044581 mRNA Translation: AAH44581.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43367.1 [Q9NZM6-5]
CCDS58971.1 [Q9NZM6-6]
CCDS58972.1 [Q9NZM6-7]
CCDS78062.1 [Q9NZM6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001245377.1, NM_001258448.1 [Q9NZM6-7]
NP_001245378.1, NM_001258449.1 [Q9NZM6-6]
NP_001287850.1, NM_001300921.1 [Q9NZM6-1]
NP_055201.2, NM_014386.3 [Q9NZM6-5]
XP_011541620.1, XM_011543318.2 [Q9NZM6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000290431; ENSP00000290431; ENSG00000078795 [Q9NZM6-5]
ENST00000414094; ENSP00000388060; ENSG00000078795 [Q9NZM6-3]
ENST00000502810; ENSP00000425513; ENSG00000078795 [Q9NZM6-7]
ENST00000508638; ENSP00000423382; ENSG00000078795 [Q9NZM6-6]
ENST00000508883; ENSP00000424725; ENSG00000078795 [Q9NZM6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27039

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:27039

UCSC genome browser

More...
UCSCi
uc003lbw.2 human [Q9NZM6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF118125 mRNA Translation: AAD46478.1 Frameshift.
AF182034 mRNA Translation: AAF65622.1
AC106753 Genomic DNA No translation available.
AK301924 mRNA Translation: BAG63344.1
AC106791 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62174.1
BC044581 mRNA Translation: AAH44581.1
CCDSiCCDS43367.1 [Q9NZM6-5]
CCDS58971.1 [Q9NZM6-6]
CCDS58972.1 [Q9NZM6-7]
CCDS78062.1 [Q9NZM6-1]
RefSeqiNP_001245377.1, NM_001258448.1 [Q9NZM6-7]
NP_001245378.1, NM_001258449.1 [Q9NZM6-6]
NP_001287850.1, NM_001300921.1 [Q9NZM6-1]
NP_055201.2, NM_014386.3 [Q9NZM6-5]
XP_011541620.1, XM_011543318.2 [Q9NZM6-2]

3D structure databases

SMRiQ9NZM6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117970, 5 interactors
IntActiQ9NZM6, 4 interactors
STRINGi9606.ENSP00000290431

PTM databases

iPTMnetiQ9NZM6
PhosphoSitePlusiQ9NZM6

Polymorphism and mutation databases

BioMutaiPKD2L2
DMDMi317373272

Proteomic databases

jPOSTiQ9NZM6
PaxDbiQ9NZM6
PeptideAtlasiQ9NZM6
PRIDEiQ9NZM6
ProteomicsDBi19398
19659
83452 [Q9NZM6-1]
83453 [Q9NZM6-2]
83454 [Q9NZM6-3]
83455 [Q9NZM6-4]
83456 [Q9NZM6-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26539 94 antibodies

Genome annotation databases

EnsembliENST00000290431; ENSP00000290431; ENSG00000078795 [Q9NZM6-5]
ENST00000414094; ENSP00000388060; ENSG00000078795 [Q9NZM6-3]
ENST00000502810; ENSP00000425513; ENSG00000078795 [Q9NZM6-7]
ENST00000508638; ENSP00000423382; ENSG00000078795 [Q9NZM6-6]
ENST00000508883; ENSP00000424725; ENSG00000078795 [Q9NZM6-1]
GeneIDi27039
KEGGihsa:27039
UCSCiuc003lbw.2 human [Q9NZM6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27039
DisGeNETi27039

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PKD2L2
HGNCiHGNC:9012 PKD2L2
HPAiENSG00000078795 Group enriched (blood, testis)
MIMi604669 gene
neXtProtiNX_Q9NZM6
OpenTargetsiENSG00000078795
PharmGKBiPA33345

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3599 Eukaryota
ENOG410XTGE LUCA
GeneTreeiENSGT00940000161122
HOGENOMiCLU_2995942_0_0_1
InParanoidiQ9NZM6
KOiK04991
OMAiNRVMRKV
OrthoDBi426073at2759
PhylomeDBiQ9NZM6
TreeFamiTF316484

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TRPP3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
27039
PharosiQ9NZM6 Tdark

Protein Ontology

More...
PROi
PR:Q9NZM6
RNActiQ9NZM6 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000078795 Expressed in tendon and 100 other tissues
ExpressionAtlasiQ9NZM6 baseline and differential
GenevisibleiQ9NZM6 HS

Family and domain databases

InterProiView protein in InterPro
IPR013122 PKD1_2_channel
IPR003915 PKD_2
PfamiView protein in Pfam
PF08016 PKD_channel, 1 hit
PRINTSiPR01433 POLYCYSTIN2

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPK2L2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZM6
Secondary accession number(s): A6NK98
, B4DXD2, E9PC91, E9PDG4, Q86YB4, Q9UNJ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: January 11, 2011
Last modified: April 22, 2020
This is version 149 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again