Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZL6 (RGL1_HUMAN)

Entry version 167 (16 Oct 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ral guanine nucleotide dissociation stimulator-like 1

Gene

RGL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable guanine nucleotide exchange factor.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1989781 PPARA activates gene expression

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 1
Short name:
RalGDS-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RGL1
Synonyms:KIAA0959, RGL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30281 RGL1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605667 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZL6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		23179

Open Targets

More...OpenTargetsi		ENSG00000143344

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134934636

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NZL6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RGL1

Domain mapping of disease mutations (DMDM)

More...DMDMi		14548230

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000688851 – 768Ral guanine nucleotide dissociation stimulator-like 1Add BLAST768

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei520PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NZL6

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NZL6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NZL6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZL6

PeptideAtlas

More...PeptideAtlasi		Q9NZL6

PRoteomics IDEntifications database

More...PRIDEi		Q9NZL6

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83430 [Q9NZL6-1]
83431 [Q9NZL6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NZL6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NZL6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000143344 Expressed in 235 organ(s), highest expression level in endothelial cell

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZL6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA019788

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with Ras.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P011123EBI-365926,EBI-350145

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		116791, 12 interactors

Database of interacting proteins

More...DIPi		DIP-31372N

Protein interaction database and analysis system

More...IntActi		Q9NZL6, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000303192

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZL6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini65 – 196N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST132
Domaini232 – 501Ras-GEFPROSITE-ProRule annotationAdd BLAST270
Domaini648 – 735Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi541 – 613Ser-richAdd BLAST73

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3629 Eukaryota
ENOG410ZUT5 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156012

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000231592

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZL6

KEGG Orthology (KO)

More...KOi		K17635

Identification of Orthologs from Complete Genome Data

More...OMAi		TDFSSAW

Database of Orthologous Groups

More...OrthoDBi		940219at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZL6

TreeFam database of animal gene trees

More...TreeFami		TF315204

Family and domain databases

Conserved Domains Database

More...CDDi		cd00155 RasGEF, 1 hit
cd06224 REM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.840.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030748 RGL1
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...PANTHERi		PTHR23113 PTHR23113, 1 hit
PTHR23113:SF199 PTHR23113:SF199, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A (identifier: Q9NZL6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLLWQAKMS SIQDWGEEVE EGAVYHVTLK RVQIQQAANK GARWLGVEGD 
        60         70         80         90        100
QLPPGHTVSQ YETCKIRTIK AGTLEKLVEN LLTAFGDNDF TYISIFLSTY 
       110        120        130        140        150
RGFASTKEVL ELLLDRYGNL TSPNCEEDGS QSSSESKMVI RNAIASILRA 
       160        170        180        190        200
WLDQCAEDFR EPPHFPCLQK LLDYLTRMMP GSDPERRAQN LLEQFQKQEV 
       210        220        230        240        250
ETDNGLPNTI SFSLEEEEEL EGGESAEFTC FSEDLVAEQL TYMDAQLFKK 
       260        270        280        290        300
VVPHHCLGCI WSRRDKKENK HLAPTIRATI SQFNTLTKCV VSTILGGKEL 
       310        320        330        340        350
KTQQRAKIIE KWINIAHECR LLKNFSSLRA IVSALQSNSI YRLKKTWAAV 
       360        370        380        390        400
PRDRMLMFEE LSDIFSDHNN HLTSRELLMK EGTSKFANLD SSVKENQKRT 
       410        420        430        440        450
QRRLQLQKDM GVMQGTVPYL GTFLTDLTML DTALQDYIEG GLINFEKRRR 
       460        470        480        490        500
EFEVIAQIKL LQSACNSYCM TPDQKFIQWF QRQQLLTEEE SYALSCEIEA 
       510        520        530        540        550
AADASTTSPK PRKSMVKRLS LLFLGSDMIT SPTPTKEQPK STASGSSGES 
       560        570        580        590        600
MDSVSVSSCE SNHSEAEEGS ITPMDTPDEP QKKLSESSSS CSSIHSMDTN 
       610        620        630        640        650
SSGMSSLINP LSSPPSCNNN PKIHKRSVSV TSITSTVLPP VYNQQNEDTC 
       660        670        680        690        700
IIRISVEDNN GNMYKSIMLT SQDKTPAVIQ RAMLKHNLDS DPAEEYELVQ 
       710        720        730        740        750
VISEDKELVI PDSANVFYAM NSQVNFDFIL RKKNSMEEQV KLRSRTSLTL 
       760 
PRTAKRGCWS NRHSKITL
Length:768
Mass (Da):86,701
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5EE4AF6D5E0C2386
GO
Isoform B (identifier: Q9NZL6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MKLLWQAKM → MEVKPVGEPTQEVSKFKLSTKVESTGHWLVEDHVRIWEVLKTEE

Show »
Length:803
Mass (Da):90,690
Checksum:i296B9ED349ECBC1C
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA76803 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti15W → G (PubMed:17974005).Curated1
Sequence conflicti687N → Y (PubMed:17974005).Curated1
Sequence conflicti761N → Y in AAF67281 (PubMed:10760592).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035823174Y → S in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_035824699V → M in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0018241 – 9MKLLWQAKM → MEVKPVGEPTQEVSKFKLST KVESTGHWLVEDHVRIWEVL KTEE in isoform B. 2 Publications9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF186779 mRNA Translation: AAF67280.1
AF186780 mRNA Translation: AAF67281.1
AF186798
, AF186781, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14400.1
AF186798
, AF192520, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14401.1
AB023176 mRNA Translation: BAA76803.1 Different initiation.
AL590422 Genomic DNA No translation available.
AL592299 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91166.1
CH471067 Genomic DNA Translation: EAW91167.1
BC136591 mRNA Translation: AAI36592.1
AL080117 mRNA Translation: CAB45716.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1359.1 [Q9NZL6-2]
CCDS72992.1 [Q9NZL6-1]

Protein sequence database of the Protein Information Resource

More...PIRi		T12453

NCBI Reference Sequences

More...RefSeqi		NP_001284598.1, NM_001297669.1
NP_001284599.1, NM_001297670.1
NP_001284600.1, NM_001297671.1 [Q9NZL6-1]
NP_001284601.1, NM_001297672.1
NP_055964.3, NM_015149.4 [Q9NZL6-2]
XP_011507641.1, XM_011509339.2 [Q9NZL6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000304685; ENSP00000303192; ENSG00000143344 [Q9NZL6-2]
ENST00000360851; ENSP00000354097; ENSG00000143344 [Q9NZL6-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23179

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23179

UCSC genome browser

More...UCSCi		uc001gqm.4 human [Q9NZL6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186779 mRNA Translation: AAF67280.1
AF186780 mRNA Translation: AAF67281.1
AF186798
, AF186781, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14400.1
AF186798
, AF192520, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14401.1
AB023176 mRNA Translation: BAA76803.1 Different initiation.
AL590422 Genomic DNA No translation available.
AL592299 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91166.1
CH471067 Genomic DNA Translation: EAW91167.1
BC136591 mRNA Translation: AAI36592.1
AL080117 mRNA Translation: CAB45716.1
CCDSiCCDS1359.1 [Q9NZL6-2]
CCDS72992.1 [Q9NZL6-1]
PIRiT12453
RefSeqiNP_001284598.1, NM_001297669.1
NP_001284599.1, NM_001297670.1
NP_001284600.1, NM_001297671.1 [Q9NZL6-1]
NP_001284601.1, NM_001297672.1
NP_055964.3, NM_015149.4 [Q9NZL6-2]
XP_011507641.1, XM_011509339.2 [Q9NZL6-2]

3D structure databases

SMRiQ9NZL6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116791, 12 interactors
DIPiDIP-31372N
IntActiQ9NZL6, 2 interactors
STRINGi9606.ENSP00000303192

PTM databases

iPTMnetiQ9NZL6
PhosphoSitePlusiQ9NZL6

Polymorphism and mutation databases

BioMutaiRGL1
DMDMi14548230

Proteomic databases

EPDiQ9NZL6
jPOSTiQ9NZL6
MassIVEiQ9NZL6
PaxDbiQ9NZL6
PeptideAtlasiQ9NZL6
PRIDEiQ9NZL6
ProteomicsDBi83430 [Q9NZL6-1]
83431 [Q9NZL6-2]

Genome annotation databases

EnsembliENST00000304685; ENSP00000303192; ENSG00000143344 [Q9NZL6-2]
ENST00000360851; ENSP00000354097; ENSG00000143344 [Q9NZL6-1]
GeneIDi23179
KEGGihsa:23179
UCSCiuc001gqm.4 human [Q9NZL6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23179
DisGeNETi23179

GeneCards: human genes, protein and diseases

More...GeneCardsi		RGL1
HGNCiHGNC:30281 RGL1
HPAiHPA019788
MIMi605667 gene
neXtProtiNX_Q9NZL6
OpenTargetsiENSG00000143344
PharmGKBiPA134934636

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00940000156012
HOGENOMiHOG000231592
InParanoidiQ9NZL6
KOiK17635
OMAiTDFSSAW
OrthoDBi940219at2759
PhylomeDBiQ9NZL6
TreeFamiTF315204

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RGL1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23179
PharosiQ9NZL6

Protein Ontology

More...PROi		PR:Q9NZL6

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000143344 Expressed in 235 organ(s), highest expression level in endothelial cell
GenevisibleiQ9NZL6 HS

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030748 RGL1
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF199 PTHR23113:SF199, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZL6
Secondary accession number(s): Q5SXQ2
, Q5SXQ6, Q9HBY3, Q9HBY4, Q9NZL5, Q9UG43, Q9Y2G6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: October 16, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again