Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator-like 1

Gene

RGL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor.

GO - Molecular functioni

  • Ral guanyl-nucleotide exchange factor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 1
Short name:
RalGDS-like 1
Gene namesi
Name:RGL1
Synonyms:KIAA0959, RGL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143344.15
HGNCiHGNC:30281 RGL1
MIMi605667 gene
neXtProtiNX_Q9NZL6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi23179
OpenTargetsiENSG00000143344
PharmGKBiPA134934636

Polymorphism and mutation databases

BioMutaiRGL1
DMDMi14548230

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688851 – 768Ral guanine nucleotide dissociation stimulator-like 1Add BLAST768

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei520PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NZL6
PaxDbiQ9NZL6
PeptideAtlasiQ9NZL6
PRIDEiQ9NZL6
ProteomicsDBi83430
83431 [Q9NZL6-2]

PTM databases

iPTMnetiQ9NZL6
PhosphoSitePlusiQ9NZL6

Expressioni

Tissue specificityi

Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis.

Gene expression databases

BgeeiENSG00000143344 Expressed in 235 organ(s), highest expression level in endothelial cell
CleanExiHS_RGL1
GenevisibleiQ9NZL6 HS

Organism-specific databases

HPAiHPA019788

Interactioni

Subunit structurei

Interacts with Ras.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
HRASP011123EBI-365926,EBI-350145

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116791, 11 interactors
DIPiDIP-31372N
IntActiQ9NZL6, 2 interactors
STRINGi9606.ENSP00000303192

Structurei

3D structure databases

ProteinModelPortaliQ9NZL6
SMRiQ9NZL6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 196N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST132
Domaini232 – 501Ras-GEFPROSITE-ProRule annotationAdd BLAST270
Domaini648 – 735Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi541 – 613Ser-richAdd BLAST73

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiQ9NZL6
KOiK17635
OMAiQSAPDFY
OrthoDBiEOG091G0761
PhylomeDBiQ9NZL6
TreeFamiTF315204

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030748 RGL1
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF199 PTHR23113:SF199, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A (identifier: Q9NZL6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLLWQAKMS SIQDWGEEVE EGAVYHVTLK RVQIQQAANK GARWLGVEGD
60 70 80 90 100
QLPPGHTVSQ YETCKIRTIK AGTLEKLVEN LLTAFGDNDF TYISIFLSTY
110 120 130 140 150
RGFASTKEVL ELLLDRYGNL TSPNCEEDGS QSSSESKMVI RNAIASILRA
160 170 180 190 200
WLDQCAEDFR EPPHFPCLQK LLDYLTRMMP GSDPERRAQN LLEQFQKQEV
210 220 230 240 250
ETDNGLPNTI SFSLEEEEEL EGGESAEFTC FSEDLVAEQL TYMDAQLFKK
260 270 280 290 300
VVPHHCLGCI WSRRDKKENK HLAPTIRATI SQFNTLTKCV VSTILGGKEL
310 320 330 340 350
KTQQRAKIIE KWINIAHECR LLKNFSSLRA IVSALQSNSI YRLKKTWAAV
360 370 380 390 400
PRDRMLMFEE LSDIFSDHNN HLTSRELLMK EGTSKFANLD SSVKENQKRT
410 420 430 440 450
QRRLQLQKDM GVMQGTVPYL GTFLTDLTML DTALQDYIEG GLINFEKRRR
460 470 480 490 500
EFEVIAQIKL LQSACNSYCM TPDQKFIQWF QRQQLLTEEE SYALSCEIEA
510 520 530 540 550
AADASTTSPK PRKSMVKRLS LLFLGSDMIT SPTPTKEQPK STASGSSGES
560 570 580 590 600
MDSVSVSSCE SNHSEAEEGS ITPMDTPDEP QKKLSESSSS CSSIHSMDTN
610 620 630 640 650
SSGMSSLINP LSSPPSCNNN PKIHKRSVSV TSITSTVLPP VYNQQNEDTC
660 670 680 690 700
IIRISVEDNN GNMYKSIMLT SQDKTPAVIQ RAMLKHNLDS DPAEEYELVQ
710 720 730 740 750
VISEDKELVI PDSANVFYAM NSQVNFDFIL RKKNSMEEQV KLRSRTSLTL
760
PRTAKRGCWS NRHSKITL
Length:768
Mass (Da):86,701
Last modified:October 1, 2000 - v1
Checksum:i5EE4AF6D5E0C2386
GO
Isoform B (identifier: Q9NZL6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MKLLWQAKM → MEVKPVGEPTQEVSKFKLSTKVESTGHWLVEDHVRIWEVLKTEE

Show »
Length:803
Mass (Da):90,690
Checksum:i296B9ED349ECBC1C
GO

Sequence cautioni

The sequence BAA76803 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti15W → G (PubMed:17974005).Curated1
Sequence conflicti687N → Y (PubMed:17974005).Curated1
Sequence conflicti761N → Y in AAF67281 (PubMed:10760592).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035823174Y → S in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_035824699V → M in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0018241 – 9MKLLWQAKM → MEVKPVGEPTQEVSKFKLST KVESTGHWLVEDHVRIWEVL KTEE in isoform B. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186779 mRNA Translation: AAF67280.1
AF186780 mRNA Translation: AAF67281.1
AF186798
, AF186781, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14400.1
AF186798
, AF192520, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14401.1
AB023176 mRNA Translation: BAA76803.1 Different initiation.
AL590422 Genomic DNA No translation available.
AL592299 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91166.1
CH471067 Genomic DNA Translation: EAW91167.1
BC136591 mRNA Translation: AAI36592.1
AL080117 mRNA Translation: CAB45716.1
CCDSiCCDS1359.1 [Q9NZL6-2]
CCDS72992.1 [Q9NZL6-1]
PIRiT12453
RefSeqiNP_001284598.1, NM_001297669.1
NP_001284599.1, NM_001297670.1
NP_001284600.1, NM_001297671.1 [Q9NZL6-1]
NP_001284601.1, NM_001297672.1
NP_055964.3, NM_015149.4 [Q9NZL6-2]
XP_011507641.1, XM_011509339.2 [Q9NZL6-2]
UniGeneiHs.497148

Genome annotation databases

EnsembliENST00000304685; ENSP00000303192; ENSG00000143344 [Q9NZL6-2]
ENST00000360851; ENSP00000354097; ENSG00000143344 [Q9NZL6-1]
GeneIDi23179
KEGGihsa:23179
UCSCiuc001gqm.4 human [Q9NZL6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186779 mRNA Translation: AAF67280.1
AF186780 mRNA Translation: AAF67281.1
AF186798
, AF186781, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14400.1
AF186798
, AF192520, AF186783, AF186784, AF186785, AF186786, AF186787, AF186788, AF186789, AF186790, AF186791, AF186792, AF186793, AF186794, AF186795, AF186796, AF186797 Genomic DNA Translation: AAG14401.1
AB023176 mRNA Translation: BAA76803.1 Different initiation.
AL590422 Genomic DNA No translation available.
AL592299 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91166.1
CH471067 Genomic DNA Translation: EAW91167.1
BC136591 mRNA Translation: AAI36592.1
AL080117 mRNA Translation: CAB45716.1
CCDSiCCDS1359.1 [Q9NZL6-2]
CCDS72992.1 [Q9NZL6-1]
PIRiT12453
RefSeqiNP_001284598.1, NM_001297669.1
NP_001284599.1, NM_001297670.1
NP_001284600.1, NM_001297671.1 [Q9NZL6-1]
NP_001284601.1, NM_001297672.1
NP_055964.3, NM_015149.4 [Q9NZL6-2]
XP_011507641.1, XM_011509339.2 [Q9NZL6-2]
UniGeneiHs.497148

3D structure databases

ProteinModelPortaliQ9NZL6
SMRiQ9NZL6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116791, 11 interactors
DIPiDIP-31372N
IntActiQ9NZL6, 2 interactors
STRINGi9606.ENSP00000303192

PTM databases

iPTMnetiQ9NZL6
PhosphoSitePlusiQ9NZL6

Polymorphism and mutation databases

BioMutaiRGL1
DMDMi14548230

Proteomic databases

EPDiQ9NZL6
PaxDbiQ9NZL6
PeptideAtlasiQ9NZL6
PRIDEiQ9NZL6
ProteomicsDBi83430
83431 [Q9NZL6-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304685; ENSP00000303192; ENSG00000143344 [Q9NZL6-2]
ENST00000360851; ENSP00000354097; ENSG00000143344 [Q9NZL6-1]
GeneIDi23179
KEGGihsa:23179
UCSCiuc001gqm.4 human [Q9NZL6-1]

Organism-specific databases

CTDi23179
DisGeNETi23179
EuPathDBiHostDB:ENSG00000143344.15
GeneCardsiRGL1
H-InvDBiHIX0001411
HGNCiHGNC:30281 RGL1
HPAiHPA019788
MIMi605667 gene
neXtProtiNX_Q9NZL6
OpenTargetsiENSG00000143344
PharmGKBiPA134934636
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3629 Eukaryota
ENOG410ZUT5 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiQ9NZL6
KOiK17635
OMAiQSAPDFY
OrthoDBiEOG091G0761
PhylomeDBiQ9NZL6
TreeFamiTF315204

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Miscellaneous databases

ChiTaRSiRGL1 human
GenomeRNAii23179
PROiPR:Q9NZL6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143344 Expressed in 235 organ(s), highest expression level in endothelial cell
CleanExiHS_RGL1
GenevisibleiQ9NZL6 HS

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030748 RGL1
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF199 PTHR23113:SF199, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRGL1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZL6
Secondary accession number(s): Q5SXQ2
, Q5SXQ6, Q9HBY3, Q9HBY4, Q9NZL5, Q9UG43, Q9Y2G6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 160 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again