Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hsp70-binding protein 1

Gene

HSPBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.4 Publications

GO - Molecular functioni

  • enzyme inhibitor activity Source: ProtInc
  • ubiquitin protein ligase binding Source: ARUK-UCL

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Hsp70-binding protein 1Curated
Short name:
HspBP1
Alternative name(s):
Heat shock protein-binding protein 1
Hsp70-binding protein 2
Short name:
HspBP2
Hsp70-interacting protein 1
Hsp70-interacting protein 2
Gene namesi
Name:HSPBP1Imported
Synonyms:HSPBP
ORF Names:PP1845
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000133265.10
HGNCiHGNC:24989 HSPBP1
MIMi612939 gene
neXtProtiNX_Q9NZL4

Pathology & Biotechi

Organism-specific databases

DisGeNETi23640
OpenTargetsiENSG00000133265
PharmGKBiPA164720725

Polymorphism and mutation databases

BioMutaiHSPBP1
DMDMi74734730

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000840351 – 359Hsp70-binding protein 1Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei351PhosphoserineCombined sources1
Modified residuei356PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NZL4
MaxQBiQ9NZL4
PaxDbiQ9NZL4
PeptideAtlasiQ9NZL4
PRIDEiQ9NZL4
ProteomicsDBi83428
83429 [Q9NZL4-2]

PTM databases

iPTMnetiQ9NZL4
PhosphoSitePlusiQ9NZL4

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000133265 Expressed in 205 organ(s), highest expression level in nucleus accumbens
ExpressionAtlasiQ9NZL4 baseline and differential
GenevisibleiQ9NZL4 HS

Organism-specific databases

HPAiCAB005865
HPA071444

Interactioni

Subunit structurei

Interacts with the ATP-binding domain of HSPA1A. Detected in a ternary complex containing STUB1, HSPA1A and HSPBP1.4 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117168, 93 interactors
IntActiQ9NZL4, 26 interactors
MINTiQ9NZL4
STRINGi9606.ENSP00000255631

Structurei

Secondary structure

1359
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NZL4
SMRiQ9NZL4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZL4

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati132 – 174ARM 1Add BLAST43
Repeati177 – 217ARM 2Add BLAST41
Repeati220 – 259ARM 3Add BLAST40
Repeati262 – 301ARM 4Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi21 – 37Gly-richAdd BLAST17

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2160 Eukaryota
ENOG410Y90B LUCA
HOGENOMiHOG000007740
HOVERGENiHBG053282
InParanoidiQ9NZL4
KOiK09562
OrthoDBiEOG091G0HDF
PhylomeDBiQ9NZL4
TreeFamiTF324307

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR013918 Nucleotide_exch_fac_Fes1
PfamiView protein in Pfam
PF08609 Fes1, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDEGSRGSR LPLALPPASQ GCSSGGGGGG SSAGGSGNSR PPRNLQGLLQ
60 70 80 90 100
MAITAGSEEP DPPPEPMSEE RRQWLQEAMS AAFRGQREEV EQMKSCLRVL
110 120 130 140 150
SQPMPPTAGE AEQAADQQER EGALELLADL CENMDNAADF CQLSGMHLLV
160 170 180 190 200
GRYLEAGAAG LRWRAAQLIG TCSQNVAAIQ EQVLGLGALR KLLRLLDRDA
210 220 230 240 250
CDTVRVKALF AISCLVREQE AGLLQFLRLD GFSVLMRAMQ QQVQKLKVKS
260 270 280 290 300
AFLLQNLLVG HPEHKGTLCS MGMVQQLVAL VRTEHSPFHE HVLGALCSLV
310 320 330 340 350
TDFPQGVREC REPELGLEEL LRHRCQLLQQ HEEYQEELEF CEKLLQTCFS

SPADDSMDR
Length:359
Mass (Da):39,303
Last modified:September 12, 2018 - v2
Checksum:i99C3B7ECD4DFAF33
GO
Isoform 2 (identifier: Q9NZL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-306: Missing.

Note: No experimental confirmation available.
Show »
Length:256
Mass (Da):27,853
Checksum:i655FC577C83E494F
GO
Isoform 3 (identifier: Q9NZL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGRRAPLKRRLLSRPSRIDPSGRQSCFSGDHLLPLTHSSLLHKRPM
     25-27: Missing.

Note: No experimental confirmation available.
Show »
Length:402
Mass (Da):44,303
Checksum:i4BE524054C4F5F33
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EL16K7EL16_HUMAN
Hsp70-binding protein 1
HSPBP1
214Annotation score:
K7EKM6K7EKM6_HUMAN
Hsp70-binding protein 1
HSPBP1
137Annotation score:
K7EMM7K7EMM7_HUMAN
Hsp70-binding protein 1
HSPBP1
190Annotation score:
K7ERT9K7ERT9_HUMAN
Hsp70-binding protein 1
HSPBP1
136Annotation score:
K7EN20K7EN20_HUMAN
Hsp70-binding protein 1
HSPBP1
97Annotation score:
K7EQQ0K7EQQ0_HUMAN
Hsp70-binding protein 1
HSPBP1
31Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti273M → V in BAG57622 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08062125G → V1 PublicationCorresponds to variant dbSNP:rs140649061Ensembl.1
Natural variantiVAR_02364530G → GGGG5 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0536811M → MGGRRAPLKRRLLSRPSRID PSGRQSCFSGDHLLPLTHSS LLHKRPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_05368225 – 27Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_015945204 – 306Missing in isoform 2. 1 PublicationAdd BLAST103

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF093420 mRNA Translation: AAC79703.1
AF187859 mRNA Translation: AAF35833.1
AB020592 mRNA Translation: BAB18742.1
AF217996 mRNA Translation: AAG17238.1
AK130636 mRNA Translation: BAC85399.1
AK294358 mRNA Translation: BAG57622.1
CR457118 mRNA Translation: CAG33399.1
AK075293 mRNA Translation: BAG52102.1
BC001236 mRNA Translation: AAH01236.1
BC002373 mRNA Translation: AAH02373.1
RefSeqiNP_001123578.1, NM_001130106.1
NP_001284529.1, NM_001297600.1 [Q9NZL4-3]
NP_036399.3, NM_012267.4
XP_016882033.1, XM_017026544.1
UniGeneiHs.53066

Genome annotation databases

EnsembliENST00000255631; ENSP00000255631; ENSG00000133265 [Q9NZL4-1]
ENST00000433386; ENSP00000398244; ENSG00000133265 [Q9NZL4-1]
ENST00000587922; ENSP00000467574; ENSG00000133265 [Q9NZL4-1]
GeneIDi23640
KEGGihsa:23640
UCSCiuc002qkc.4 human [Q9NZL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF093420 mRNA Translation: AAC79703.1
AF187859 mRNA Translation: AAF35833.1
AB020592 mRNA Translation: BAB18742.1
AF217996 mRNA Translation: AAG17238.1
AK130636 mRNA Translation: BAC85399.1
AK294358 mRNA Translation: BAG57622.1
CR457118 mRNA Translation: CAG33399.1
AK075293 mRNA Translation: BAG52102.1
BC001236 mRNA Translation: AAH01236.1
BC002373 mRNA Translation: AAH02373.1
RefSeqiNP_001123578.1, NM_001130106.1
NP_001284529.1, NM_001297600.1 [Q9NZL4-3]
NP_036399.3, NM_012267.4
XP_016882033.1, XM_017026544.1
UniGeneiHs.53066

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XQRX-ray2.10A/B84-359[»]
1XQSX-ray2.90A/B84-359[»]
ProteinModelPortaliQ9NZL4
SMRiQ9NZL4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117168, 93 interactors
IntActiQ9NZL4, 26 interactors
MINTiQ9NZL4
STRINGi9606.ENSP00000255631

PTM databases

iPTMnetiQ9NZL4
PhosphoSitePlusiQ9NZL4

Polymorphism and mutation databases

BioMutaiHSPBP1
DMDMi74734730

Proteomic databases

EPDiQ9NZL4
MaxQBiQ9NZL4
PaxDbiQ9NZL4
PeptideAtlasiQ9NZL4
PRIDEiQ9NZL4
ProteomicsDBi83428
83429 [Q9NZL4-2]

Protocols and materials databases

DNASUi23640
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000255631; ENSP00000255631; ENSG00000133265 [Q9NZL4-1]
ENST00000433386; ENSP00000398244; ENSG00000133265 [Q9NZL4-1]
ENST00000587922; ENSP00000467574; ENSG00000133265 [Q9NZL4-1]
GeneIDi23640
KEGGihsa:23640
UCSCiuc002qkc.4 human [Q9NZL4-1]

Organism-specific databases

CTDi23640
DisGeNETi23640
EuPathDBiHostDB:ENSG00000133265.10
GeneCardsiHSPBP1
H-InvDBiHIX0015460
HGNCiHGNC:24989 HSPBP1
HPAiCAB005865
HPA071444
MIMi612939 gene
neXtProtiNX_Q9NZL4
OpenTargetsiENSG00000133265
PharmGKBiPA164720725
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2160 Eukaryota
ENOG410Y90B LUCA
HOGENOMiHOG000007740
HOVERGENiHBG053282
InParanoidiQ9NZL4
KOiK09562
OrthoDBiEOG091G0HDF
PhylomeDBiQ9NZL4
TreeFamiTF324307

Miscellaneous databases

ChiTaRSiHSPBP1 human
EvolutionaryTraceiQ9NZL4
GeneWikiiHSPBP1
GenomeRNAii23640
PROiPR:Q9NZL4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000133265 Expressed in 205 organ(s), highest expression level in nucleus accumbens
ExpressionAtlasiQ9NZL4 baseline and differential
GenevisibleiQ9NZL4 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR013918 Nucleotide_exch_fac_Fes1
PfamiView protein in Pfam
PF08609 Fes1, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHPBP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZL4
Secondary accession number(s): B3KQP0
, B4DG11, O95351, Q6ZNU5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: September 12, 2018
Last modified: October 10, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again