Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZL4 (HPBP1_HUMAN)

Entry version 153 (17 Jun 2020)
Sequence version 2 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Hsp70-binding protein 1

Gene

HSPBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hsp70-binding protein 1Curated
Short name:
HspBP1
Alternative name(s):
Heat shock protein-binding protein 1
Hsp70-binding protein 2
Short name:
HspBP2
Hsp70-interacting protein 1
Hsp70-interacting protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HSPBP1Imported
Synonyms:HSPBP
ORF Names:PP1845
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000133265.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:24989 HSPBP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612939 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZL4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		23640

Open Targets

More...OpenTargetsi		ENSG00000133265

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164720725

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NZL4 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HSPBP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74734730

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000840351 – 359Hsp70-binding protein 1Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei351PhosphoserineCombined sources1
Modified residuei356PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NZL4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NZL4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NZL4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZL4

PeptideAtlas

More...PeptideAtlasi		Q9NZL4

PRoteomics IDEntifications database

More...PRIDEi		Q9NZL4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83428 [Q9NZL4-1]
83429 [Q9NZL4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NZL4

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9NZL4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NZL4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000133265 Expressed in nucleus accumbens and 204 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NZL4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZL4 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000133265 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the ATP-binding domain of HSPA1A. Detected in a ternary complex containing STUB1, HSPA1A and HSPBP1.

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117168, 103 interactors

Protein interaction database and analysis system

More...IntActi		Q9NZL4, 63 interactors

Molecular INTeraction database

More...MINTi		Q9NZL4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000255631

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NZL4 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1359
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZL4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NZL4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati132 – 174ARM 1Add BLAST43
Repeati177 – 217ARM 2Add BLAST41
Repeati220 – 259ARM 3Add BLAST40
Repeati262 – 301ARM 4Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 37Gly-richAdd BLAST17

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2160 Eukaryota
ENOG410Y90B LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153909

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_049387_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZL4

KEGG Orthology (KO)

More...KOi		K09562

Identification of Orthologs from Complete Genome Data

More...OMAi		LCCLVED

Database of Orthologous Groups

More...OrthoDBi		1310125at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZL4

TreeFam database of animal gene trees

More...TreeFami		TF324307

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR013918 Nucleotide_exch_fac_Fes1

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08609 Fes1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDEGSRGSR LPLALPPASQ GCSSGGGGGG SSAGGSGNSR PPRNLQGLLQ 
        60         70         80         90        100
MAITAGSEEP DPPPEPMSEE RRQWLQEAMS AAFRGQREEV EQMKSCLRVL 
       110        120        130        140        150
SQPMPPTAGE AEQAADQQER EGALELLADL CENMDNAADF CQLSGMHLLV 
       160        170        180        190        200
GRYLEAGAAG LRWRAAQLIG TCSQNVAAIQ EQVLGLGALR KLLRLLDRDA 
       210        220        230        240        250
CDTVRVKALF AISCLVREQE AGLLQFLRLD GFSVLMRAMQ QQVQKLKVKS 
       260        270        280        290        300
AFLLQNLLVG HPEHKGTLCS MGMVQQLVAL VRTEHSPFHE HVLGALCSLV 
       310        320        330        340        350
TDFPQGVREC REPELGLEEL LRHRCQLLQQ HEEYQEELEF CEKLLQTCFS 

SPADDSMDR
Length:359
Mass (Da):39,303
Last modified:September 12, 2018 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99C3B7ECD4DFAF33
GO
Isoform 2 (identifier: Q9NZL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-306: Missing.

Show »
Length:256
Mass (Da):27,853
Checksum:i655FC577C83E494F
GO
Isoform 3 (identifier: Q9NZL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGRRAPLKRRLLSRPSRIDPSGRQSCFSGDHLLPLTHSSLLHKRPM
     25-27: Missing.

Show »
Length:402
Mass (Da):44,303
Checksum:i4BE524054C4F5F33
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EL16K7EL16_HUMAN
Hsp70-binding protein 1
HSPBP1
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKM6K7EKM6_HUMAN
Hsp70-binding protein 1
HSPBP1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMM7K7EMM7_HUMAN
Hsp70-binding protein 1
HSPBP1
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERT9K7ERT9_HUMAN
Hsp70-binding protein 1
HSPBP1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQQ0K7EQQ0_HUMAN
Hsp70-binding protein 1
HSPBP1
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EN20K7EN20_HUMAN
Hsp70-binding protein 1
HSPBP1
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti273M → V in BAG57622 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08062125G → V1 PublicationCorresponds to variant dbSNP:rs140649061Ensembl.1
Natural variantiVAR_02364530G → GGGG5 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0536811M → MGGRRAPLKRRLLSRPSRID PSGRQSCFSGDHLLPLTHSS LLHKRPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_05368225 – 27Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_015945204 – 306Missing in isoform 2. 1 PublicationAdd BLAST103

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF093420 mRNA Translation: AAC79703.1
AF187859 mRNA Translation: AAF35833.1
AB020592 mRNA Translation: BAB18742.1
AF217996 mRNA Translation: AAG17238.1
AK130636 mRNA Translation: BAC85399.1
AK294358 mRNA Translation: BAG57622.1
CR457118 mRNA Translation: CAG33399.1
AK075293 mRNA Translation: BAG52102.1
BC001236 mRNA Translation: AAH01236.1
BC002373 mRNA Translation: AAH02373.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33111.1 [Q9NZL4-1]

NCBI Reference Sequences

More...RefSeqi		NP_001123578.1, NM_001130106.1 [Q9NZL4-1]
NP_001284529.1, NM_001297600.1
NP_036399.3, NM_012267.4 [Q9NZL4-1]
XP_016882033.1, XM_017026544.1 [Q9NZL4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000255631; ENSP00000255631; ENSG00000133265 [Q9NZL4-1]
ENST00000433386; ENSP00000398244; ENSG00000133265 [Q9NZL4-1]
ENST00000587922; ENSP00000467574; ENSG00000133265 [Q9NZL4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23640

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23640

UCSC genome browser

More...UCSCi		uc002qkc.4 human [Q9NZL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF093420 mRNA Translation: AAC79703.1
AF187859 mRNA Translation: AAF35833.1
AB020592 mRNA Translation: BAB18742.1
AF217996 mRNA Translation: AAG17238.1
AK130636 mRNA Translation: BAC85399.1
AK294358 mRNA Translation: BAG57622.1
CR457118 mRNA Translation: CAG33399.1
AK075293 mRNA Translation: BAG52102.1
BC001236 mRNA Translation: AAH01236.1
BC002373 mRNA Translation: AAH02373.1
CCDSiCCDS33111.1 [Q9NZL4-1]
RefSeqiNP_001123578.1, NM_001130106.1 [Q9NZL4-1]
NP_001284529.1, NM_001297600.1
NP_036399.3, NM_012267.4 [Q9NZL4-1]
XP_016882033.1, XM_017026544.1 [Q9NZL4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XQRX-ray2.10A/B84-359[»]
1XQSX-ray2.90A/B84-359[»]
SMRiQ9NZL4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117168, 103 interactors
IntActiQ9NZL4, 63 interactors
MINTiQ9NZL4
STRINGi9606.ENSP00000255631

PTM databases

iPTMnetiQ9NZL4
MetOSiteiQ9NZL4
PhosphoSitePlusiQ9NZL4

Polymorphism and mutation databases

BioMutaiHSPBP1
DMDMi74734730

Proteomic databases

EPDiQ9NZL4
jPOSTiQ9NZL4
MassIVEiQ9NZL4
PaxDbiQ9NZL4
PeptideAtlasiQ9NZL4
PRIDEiQ9NZL4
ProteomicsDBi83428 [Q9NZL4-1]
83429 [Q9NZL4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33053 292 antibodies

The DNASU plasmid repository

More...DNASUi		23640

Genome annotation databases

EnsembliENST00000255631; ENSP00000255631; ENSG00000133265 [Q9NZL4-1]
ENST00000433386; ENSP00000398244; ENSG00000133265 [Q9NZL4-1]
ENST00000587922; ENSP00000467574; ENSG00000133265 [Q9NZL4-1]
GeneIDi23640
KEGGihsa:23640
UCSCiuc002qkc.4 human [Q9NZL4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23640
DisGeNETi23640
EuPathDBiHostDB:ENSG00000133265.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		HSPBP1
HGNCiHGNC:24989 HSPBP1
HPAiENSG00000133265 Low tissue specificity
MIMi612939 gene
neXtProtiNX_Q9NZL4
OpenTargetsiENSG00000133265
PharmGKBiPA164720725

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2160 Eukaryota
ENOG410Y90B LUCA
GeneTreeiENSGT00940000153909
HOGENOMiCLU_049387_0_1_1
InParanoidiQ9NZL4
KOiK09562
OMAiLCCLVED
OrthoDBi1310125at2759
PhylomeDBiQ9NZL4
TreeFamiTF324307

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23640 2 hits in 785 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HSPBP1 human
EvolutionaryTraceiQ9NZL4

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HSPBP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23640
PharosiQ9NZL4 Tbio

Protein Ontology

More...PROi		PR:Q9NZL4
RNActiQ9NZL4 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000133265 Expressed in nucleus accumbens and 204 other tissues
ExpressionAtlasiQ9NZL4 baseline and differential
GenevisibleiQ9NZL4 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR013918 Nucleotide_exch_fac_Fes1
PfamiView protein in Pfam
PF08609 Fes1, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHPBP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZL4
Secondary accession number(s): B3KQP0
, B4DG11, O95351, Q6ZNU5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: September 12, 2018
Last modified: June 17, 2020
This is version 153 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again