Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZI2 (KCIP1_HUMAN)

Protein

Kv channel-interacting protein 1

Gene

KCNIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Increases the presence of KCND2 at the cell surface.4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi146 – 1571PROSITE-ProRule annotation2 PublicationsAdd BLAST12
Calcium bindingi194 – 2052PROSITE-ProRule annotation2 PublicationsAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Metal-binding, Potassium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5576894 Phase 1 - inactivation of fast Na+ channels

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.82.2.6 the calmodulin calcium binding protein (calmodulin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kv channel-interacting protein 1
Short name:
KChIP11 Publication
Alternative name(s):
A-type potassium channel modulatory protein 1
Potassium channel-interacting protein 1
Vesicle APC-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNIP1
Synonyms:KCHIP1, VABP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000182132.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:15521 KCNIP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604660 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZI2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		30820

Open Targets

More...OpenTargetsi		ENSG00000182132

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30041

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...DMDMi		73621122

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000738181 – 227Kv channel-interacting protein 1Add BLAST227

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZI2

PeptideAtlas

More...PeptideAtlasi		Q9NZI2

PRoteomics IDEntifications database

More...PRIDEi		Q9NZI2

ProteomicsDB human proteome resource

More...ProteomicsDBi		83400
83401 [Q9NZI2-2]
83402 [Q9NZI2-3]
83403 [Q9NZI2-4]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000182132 Expressed in 100 organ(s), highest expression level in nucleus accumbens

CleanEx database of gene expression profiles

More...CleanExi		HS_KCNIP1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NZI2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZI2 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA022864

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of heteromultimeric potassium channels. Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Part of a heterooctamer composed of the tetrameric channel and four KCNIP1 chains. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3.By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		119044, 6 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-3256 Kv4.3-KChIP1 channel complex

Database of interacting proteins

More...DIPi		DIP-29246N

Protein interaction database and analysis system

More...IntActi		Q9NZI2, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000395323

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9NZI2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZI2

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NZI2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini38 – 94EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini97 – 132EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini133 – 168EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini181 – 216EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni214 – 227Interaction with KCND2By similarityAdd BLAST14

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the recoverin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0044 Eukaryota
COG5126 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158048

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000233019

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG108179

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZI2

Identification of Orthologs from Complete Genome Data

More...OMAi		TDAPKQH

Database of Orthologous Groups

More...OrthoDBi		EOG091G11T4

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZI2

TreeFam database of animal gene trees

More...TreeFami		TF318560

Family and domain databases

Conserved Domains Database

More...CDDi		cd00051 EFh, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054 EFh, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473 SSF47473, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZI2-1) [UniParc]FASTAAdd to basket
Also known as: KCHIP1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAVMGTFSS LQTKQRRPSK DIAWWYYQYQ RDKIEDELEM TMVCHRPEGL 
        60         70         80         90        100
EQLEAQTNFT KRELQVLYRG FKNECPSGVV NEDTFKQIYA QFFPHGDAST 
       110        120        130        140        150
YAHYLFNAFD TTQTGSVKFE DFVTALSILL RGTVHEKLRW TFNLYDINKD 
       160        170        180        190        200
GYINKEEMMD IVKAIYDMMG KYTYPVLKED TPRQHVDVFF QKMDKNKDGI 
       210        220 
VTLDEFLESC QEDDNIMRSL QLFQNVM
Length:227
Mass (Da):26,817
Last modified:August 16, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD39DD5F8EA13B0FD
GO
Isoform 2 (identifier: Q9NZI2-2) [UniParc]FASTAAdd to basket
Also known as: KCHIP1a

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     93-130: Missing.

Show »
Length:178
Mass (Da):21,036
Checksum:i8D1E9F2FEB2D5502
GO
Isoform 3 (identifier: Q9NZI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:188
Mass (Da):22,079
Checksum:i5712C89FF2FA0176
GO
Isoform 4 (identifier: Q9NZI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK

Show »
Length:225
Mass (Da):26,227
Checksum:i15705CD8C4385B7B
GO
Isoform 5 (identifier: Q9NZI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     96-96: G → GALPCLEGSPCVEFLPPSPALLFCLV

Show »
Length:241
Mass (Da):27,842
Checksum:i856A1EC2DEE17668
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DFQ7A0A0C4DFQ7_HUMAN
Kv channel-interacting protein 1
KCNIP1
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTU8A0A087WTU8_HUMAN
Kv channel-interacting protein 1
KCNIP1
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MS16A0A0A0MS16_HUMAN
Kv channel-interacting protein 1
KCNIP1
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTZ7A0A1B0GTZ7_HUMAN
Kv channel-interacting protein 1
KCNIP1
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJY5E5RJY5_HUMAN
Kv channel-interacting protein 1
KCNIP1
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti116S → P in BAH13550 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0150431 – 39Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0415111 – 31MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_01504421 – 31Missing in isoform 2 and isoform 5. 4 PublicationsAdd BLAST11
Alternative sequenceiVSP_04768693 – 130Missing in isoform 2. 4 PublicationsAdd BLAST38
Alternative sequenceiVSP_04768796G → GALPCLEGSPCVEFLPPSPA LLFCLV in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF199597 mRNA Translation: AAF33682.1
AY170821 mRNA Translation: AAN77491.1
DQ148476 mRNA Translation: AAZ77793.1
DQ148477 mRNA Translation: AAZ77794.1
DQ148478 mRNA Translation: AAZ77795.1
DQ148479 mRNA Translation: AAZ77796.1
AY780424 mRNA Translation: AAV51968.1
AK301775 mRNA Translation: BAH13550.1
AC008619 Genomic DNA No translation available.
AC008719 Genomic DNA No translation available.
AC027306 Genomic DNA No translation available.
AC027312 Genomic DNA No translation available.
AC034199 Genomic DNA No translation available.
AC113432 Genomic DNA No translation available.
AC134820 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61470.1
BC050375 mRNA Translation: AAH50375.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34285.1 [Q9NZI2-4]
CCDS34286.1 [Q9NZI2-1]
CCDS64312.1 [Q9NZI2-5]
CCDS64313.1 [Q9NZI2-3]

NCBI Reference Sequences

More...RefSeqi		NP_001030009.1, NM_001034837.2 [Q9NZI2-1]
NP_001030010.1, NM_001034838.2 [Q9NZI2-4]
NP_001265268.1, NM_001278339.1 [Q9NZI2-5]
NP_001265269.1, NM_001278340.1 [Q9NZI2-3]
NP_055407.1, NM_014592.3
XP_016864896.1, XM_017009407.1 [Q9NZI2-4]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.484111

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000377360; ENSP00000366577; ENSG00000182132 [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132 [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132 [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132 [Q9NZI2-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		30820

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:30820

UCSC genome browser

More...UCSCi		uc003map.5 human [Q9NZI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF199597 mRNA Translation: AAF33682.1
AY170821 mRNA Translation: AAN77491.1
DQ148476 mRNA Translation: AAZ77793.1
DQ148477 mRNA Translation: AAZ77794.1
DQ148478 mRNA Translation: AAZ77795.1
DQ148479 mRNA Translation: AAZ77796.1
AY780424 mRNA Translation: AAV51968.1
AK301775 mRNA Translation: BAH13550.1
AC008619 Genomic DNA No translation available.
AC008719 Genomic DNA No translation available.
AC027306 Genomic DNA No translation available.
AC027312 Genomic DNA No translation available.
AC034199 Genomic DNA No translation available.
AC113432 Genomic DNA No translation available.
AC134820 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61470.1
BC050375 mRNA Translation: AAH50375.1
CCDSiCCDS34285.1 [Q9NZI2-4]
CCDS34286.1 [Q9NZI2-1]
CCDS64312.1 [Q9NZI2-5]
CCDS64313.1 [Q9NZI2-3]
RefSeqiNP_001030009.1, NM_001034837.2 [Q9NZI2-1]
NP_001030010.1, NM_001034838.2 [Q9NZI2-4]
NP_001265268.1, NM_001278339.1 [Q9NZI2-5]
NP_001265269.1, NM_001278340.1 [Q9NZI2-3]
NP_055407.1, NM_014592.3
XP_016864896.1, XM_017009407.1 [Q9NZI2-4]
UniGeneiHs.484111

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S1EX-ray2.30A1-227[»]
2I2RX-ray3.35E/F/G/H/M/N/O/P48-227[»]
2NZ0X-ray3.20A/C49-227[»]
ProteinModelPortaliQ9NZI2
SMRiQ9NZI2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119044, 6 interactors
ComplexPortaliCPX-3256 Kv4.3-KChIP1 channel complex
DIPiDIP-29246N
IntActiQ9NZI2, 4 interactors
STRINGi9606.ENSP00000395323

Protein family/group databases

TCDBi8.A.82.2.6 the calmodulin calcium binding protein (calmodulin) family

Polymorphism and mutation databases

DMDMi73621122

Proteomic databases

PaxDbiQ9NZI2
PeptideAtlasiQ9NZI2
PRIDEiQ9NZI2
ProteomicsDBi83400
83401 [Q9NZI2-2]
83402 [Q9NZI2-3]
83403 [Q9NZI2-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		30820
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377360; ENSP00000366577; ENSG00000182132 [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132 [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132 [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132 [Q9NZI2-3]
GeneIDi30820
KEGGihsa:30820
UCSCiuc003map.5 human [Q9NZI2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		30820
DisGeNETi30820
EuPathDBiHostDB:ENSG00000182132.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		KCNIP1
HGNCiHGNC:15521 KCNIP1
HPAiHPA022864
MIMi604660 gene
neXtProtiNX_Q9NZI2
OpenTargetsiENSG00000182132
PharmGKBiPA30041

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0044 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00940000158048
HOGENOMiHOG000233019
HOVERGENiHBG108179
InParanoidiQ9NZI2
OMAiTDAPKQH
OrthoDBiEOG091G11T4
PhylomeDBiQ9NZI2
TreeFamiTF318560

Enzyme and pathway databases

ReactomeiR-HSA-5576894 Phase 1 - inactivation of fast Na+ channels

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KCNIP1 human
EvolutionaryTraceiQ9NZI2

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KCNIP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		30820

Protein Ontology

More...PROi		PR:Q9NZI2

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000182132 Expressed in 100 organ(s), highest expression level in nucleus accumbens
CleanExiHS_KCNIP1
ExpressionAtlasiQ9NZI2 baseline and differential
GenevisibleiQ9NZI2 HS

Family and domain databases

CDDicd00051 EFh, 2 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCIP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZI2
Secondary accession number(s): B7Z7B4
, Q3YAD0, Q3YAD1, Q3YAD2, Q3YAD3, Q5U822
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: December 5, 2018
This is version 153 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again