Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 1

Gene

KCNIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Increases the presence of KCND2 at the cell surface.4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi146 – 1571PROSITE-ProRule annotation2 PublicationsAdd BLAST12
Calcium bindingi194 – 2052PROSITE-ProRule annotation2 PublicationsAdd BLAST12

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • potassium channel activity Source: UniProtKB-KW
  • potassium channel regulator activity Source: UniProtKB
  • voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

  • regulation of potassium ion transmembrane transport Source: UniProtKB

Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Metal-binding, Potassium

Enzyme and pathway databases

ReactomeiR-HSA-5576894 Phase 1 - inactivation of fast Na+ channels

Protein family/group databases

TCDBi8.A.82.2.6 the calmodulin calcium binding protein (calmodulin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 1
Short name:
KChIP11 Publication
Alternative name(s):
A-type potassium channel modulatory protein 1
Potassium channel-interacting protein 1
Vesicle APC-binding protein
Gene namesi
Name:KCNIP1
Synonyms:KCHIP1, VABP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000182132.12
HGNCiHGNC:15521 KCNIP1
MIMi604660 gene
neXtProtiNX_Q9NZI2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi30820
OpenTargetsiENSG00000182132
PharmGKBiPA30041

Polymorphism and mutation databases

DMDMi73621122

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738181 – 227Kv channel-interacting protein 1Add BLAST227

Proteomic databases

PaxDbiQ9NZI2
PeptideAtlasiQ9NZI2
PRIDEiQ9NZI2
ProteomicsDBi83400
83401 [Q9NZI2-2]
83402 [Q9NZI2-3]
83403 [Q9NZI2-4]

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

Gene expression databases

BgeeiENSG00000182132
CleanExiHS_KCNIP1
ExpressionAtlasiQ9NZI2 baseline and differential
GenevisibleiQ9NZI2 HS

Organism-specific databases

HPAiHPA022864

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels. Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Part of a heterooctamer composed of the tetrameric channel and four KCNIP1 chains. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3.By similarity6 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119044, 6 interactors
ComplexPortaliCPX-3256 Kv4.3-KChIP1 channel complex
DIPiDIP-29246N
IntActiQ9NZI2, 4 interactors
STRINGi9606.ENSP00000395323

Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi50 – 56Combined sources7
Beta strandi57 – 59Combined sources3
Helixi61 – 74Combined sources14
Turni76 – 78Combined sources3
Helixi82 – 90Combined sources9
Beta strandi93 – 96Combined sources4
Helixi99 – 109Combined sources11
Beta strandi112 – 116Combined sources5
Helixi119 – 131Combined sources13
Helixi134 – 145Combined sources12
Beta strandi151 – 153Combined sources3
Helixi155 – 169Combined sources15
Helixi175 – 177Combined sources3
Beta strandi179 – 181Combined sources3
Helixi182 – 193Combined sources12
Beta strandi198 – 201Combined sources4
Helixi203 – 211Combined sources9
Helixi214 – 225Combined sources12

3D structure databases

ProteinModelPortaliQ9NZI2
SMRiQ9NZI2
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZI2

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini38 – 94EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini97 – 132EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini133 – 168EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini181 – 216EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni214 – 227Interaction with KCND2By similarityAdd BLAST14

Sequence similaritiesi

Belongs to the recoverin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00760000118820
HOGENOMiHOG000233019
HOVERGENiHBG108179
InParanoidiQ9NZI2
OMAiTDAPKQH
OrthoDBiEOG091G11T4
PhylomeDBiQ9NZI2
TreeFamiTF318560

Family and domain databases

CDDicd00051 EFh, 2 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 3 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZI2-1) [UniParc]FASTAAdd to basket
Also known as: KCHIP1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAVMGTFSS LQTKQRRPSK DIAWWYYQYQ RDKIEDELEM TMVCHRPEGL
60 70 80 90 100
EQLEAQTNFT KRELQVLYRG FKNECPSGVV NEDTFKQIYA QFFPHGDAST
110 120 130 140 150
YAHYLFNAFD TTQTGSVKFE DFVTALSILL RGTVHEKLRW TFNLYDINKD
160 170 180 190 200
GYINKEEMMD IVKAIYDMMG KYTYPVLKED TPRQHVDVFF QKMDKNKDGI
210 220
VTLDEFLESC QEDDNIMRSL QLFQNVM
Length:227
Mass (Da):26,817
Last modified:August 16, 2005 - v2
Checksum:iD39DD5F8EA13B0FD
GO
Isoform 2 (identifier: Q9NZI2-2) [UniParc]FASTAAdd to basket
Also known as: KCHIP1a

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     93-130: Missing.

Show »
Length:178
Mass (Da):21,036
Checksum:i8D1E9F2FEB2D5502
GO
Isoform 3 (identifier: Q9NZI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:188
Mass (Da):22,079
Checksum:i5712C89FF2FA0176
GO
Isoform 4 (identifier: Q9NZI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK

Show »
Length:225
Mass (Da):26,227
Checksum:i15705CD8C4385B7B
GO
Isoform 5 (identifier: Q9NZI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     96-96: G → GALPCLEGSPCVEFLPPSPALLFCLV

Show »
Length:241
Mass (Da):27,842
Checksum:i856A1EC2DEE17668
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti116S → P in BAH13550 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150431 – 39Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0415111 – 31MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_01504421 – 31Missing in isoform 2 and isoform 5. 4 PublicationsAdd BLAST11
Alternative sequenceiVSP_04768693 – 130Missing in isoform 2. 4 PublicationsAdd BLAST38
Alternative sequenceiVSP_04768796G → GALPCLEGSPCVEFLPPSPA LLFCLV in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF199597 mRNA Translation: AAF33682.1
AY170821 mRNA Translation: AAN77491.1
DQ148476 mRNA Translation: AAZ77793.1
DQ148477 mRNA Translation: AAZ77794.1
DQ148478 mRNA Translation: AAZ77795.1
DQ148479 mRNA Translation: AAZ77796.1
AY780424 mRNA Translation: AAV51968.1
AK301775 mRNA Translation: BAH13550.1
AC008619 Genomic DNA No translation available.
AC008719 Genomic DNA No translation available.
AC027306 Genomic DNA No translation available.
AC027312 Genomic DNA No translation available.
AC034199 Genomic DNA No translation available.
AC113432 Genomic DNA No translation available.
AC134820 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61470.1
BC050375 mRNA Translation: AAH50375.1
CCDSiCCDS34285.1 [Q9NZI2-4]
CCDS34286.1 [Q9NZI2-1]
CCDS64312.1 [Q9NZI2-5]
CCDS64313.1 [Q9NZI2-3]
RefSeqiNP_001030009.1, NM_001034837.2 [Q9NZI2-1]
NP_001030010.1, NM_001034838.2 [Q9NZI2-4]
NP_001265268.1, NM_001278339.1 [Q9NZI2-5]
NP_001265269.1, NM_001278340.1 [Q9NZI2-3]
NP_055407.1, NM_014592.3
XP_016864896.1, XM_017009407.1 [Q9NZI2-4]
UniGeneiHs.484111

Genome annotation databases

EnsembliENST00000377360; ENSP00000366577; ENSG00000182132 [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132 [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132 [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132 [Q9NZI2-3]
GeneIDi30820
KEGGihsa:30820
UCSCiuc003map.5 human [Q9NZI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKCIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZI2
Secondary accession number(s): B7Z7B4
, Q3YAD0, Q3YAD1, Q3YAD2, Q3YAD3, Q5U822
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: June 20, 2018
This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health