IL36G

Functionⁱ

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.6 Publications

GO - Molecular functionⁱ

cytokine activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
interleukin-1 receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell-cell signaling
Source: ProtInc
Traceable author statementⁱ
- 10744718
cellular response to lipopolysaccharide
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
cytokine-mediated signaling pathway
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
inflammatory response Source: UniProtKB-KW
innate immune response Source: UniProtKB-KW
negative regulation of myoblast differentiation
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
negative regulation of myoblast fusion
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
neutrophil chemotaxis
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
positive regulation of I-kappaB kinase/NF-kappaB signaling
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
positive regulation of interleukin-6 production
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
positive regulation of JNK cascade
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Cytokine
Biological process	Immunity, Inflammatory response, Innate immunity

Enzyme and pathway databases

Reactomeⁱ	R-HSA-9014826 Interleukin-36 pathway
SignaLinkⁱ	Q9NZH8

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Interleukin-36 gamma Alternative name(s): IL-1-related protein 2 Short name: IL-1RP2 Interleukin-1 epsilon Short name: IL-1 epsilon Interleukin-1 family member 9 Short name: IL-1F9 Interleukin-1 homolog 1 Short name: IL-1H1
Gene namesⁱ	Name:IL36G Synonyms:IL1E, IL1F9, IL1H1, IL1RP2 ORF Names:UNQ2456/PRO5737
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000136688.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:15741 IL36G
MIMⁱ	605542 gene
neXtProtⁱ	NX_Q9NZH8

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Secreted

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	56300
Open Targets More...OpenTargetsⁱ	ENSG00000136688
PharmGKBⁱ	PA38395

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
PropeptideⁱPRO_0000430549	1 – 17	1 PublicationAdd BLAST		17
ChainⁱPRO_0000153648	18 – 169	Interleukin-36 gammaAdd BLAST		152

Post-translational modificationⁱ

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).1 Publication

Proteomic databases

EPDⁱ	Q9NZH8
PaxDbⁱ	Q9NZH8
PeptideAtlas More...PeptideAtlasⁱ	Q9NZH8
PRIDEⁱ	Q9NZH8
ProteomicsDBⁱ	83397 83398 [Q9NZH8-2]

PTM databases

iPTMnetⁱ	Q9NZH8
PhosphoSitePlusⁱ	Q9NZH8

Expressionⁱ

Tissue specificityⁱ

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.2 Publications

Inductionⁱ

By TNF and by IFNG/IFN-gamma in keratinocytes. By Aspergillus fumigatus conidia in peripheral blood mnonocytes; involves CLEC7A and SYK.2 Publications

Gene expression databases

Bgeeⁱ	ENSG00000136688 Expressed in 63 organ(s), highest expression level in periodontal ligament
CleanExⁱ	HS_IL1F9
ExpressionAtlasⁱ	Q9NZH8 baseline and differential
Genevisibleⁱ	Q9NZH8 HS

Interactionⁱ

GO - Molecular functionⁱ

cytokine activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
interleukin-1 receptor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	121135, 8 interactors
STRINGⁱ	9606.ENSP00000259205

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	23 – 29	Combined sources	7
Beta strandⁱ	33 – 38	Combined sources	6
Beta strandⁱ	41 – 46	Combined sources	6
Helixⁱ	47 – 49	Combined sources	3
Beta strandⁱ	55 – 60	Combined sources	6
Helixⁱ	64 – 66	Combined sources	3
Helixⁱ	69 – 71	Combined sources	3
Beta strandⁱ	73 – 80	Combined sources	8
Turnⁱ	81 – 83	Combined sources	3
Beta strandⁱ	84 – 89	Combined sources	6
Beta strandⁱ	91 – 94	Combined sources	4
Beta strandⁱ	96 – 101	Combined sources	6
Helixⁱ	104 – 109	Combined sources	6
Beta strandⁱ	110 – 112	Combined sources	3
Helixⁱ	115 – 117	Combined sources	3
Beta strandⁱ	118 – 124	Combined sources	7
Beta strandⁱ	127 – 135	Combined sources	9
Beta strandⁱ	139 – 142	Combined sources	4
Beta strandⁱ	150 – 153	Combined sources	4
Beta strandⁱ	156 – 160	Combined sources	5
Beta strandⁱ	163 – 167	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9NZH8
SMRⁱ	Q9NZH8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the IL-1 family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410J1V3 Eukaryota ENOG4111C31 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00900000141014
HOVERGENⁱ	HBG052100
InParanoidⁱ	Q9NZH8
KEGG Orthology (KO) More...KOⁱ	K05487
OMAⁱ	PFLFYRV
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0V8E
PhylomeDBⁱ	Q9NZH8
TreeFamⁱ	TF300203

Family and domain databases

InterProⁱ	View protein in InterPro IPR000975 IL-1_fam IPR003297 IL-1RA/IL-36 IPR008996 IL1/FGF
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00340 IL1, 1 hit
PRINTSⁱ	PR00264 INTERLEUKIN1 PR01360 INTRLEUKIN1X
SUPFAMⁱ	SSF50353 SSF50353, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform 1 (identifier: Q9NZH8-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS 
        60         70         80         90        100
VTPVTVAVIT CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK 
       110        120        130        140        150
EQKIMDLYGQ PEPVKPFLFY RAKTGRTSTL ESVAFPDWFI ASSKRDQPII 
       160 
LTSELGKSYN TAFELNIND

Length:169

Mass (Da):18,721

Last modified:October 1, 2000 - v1

Checksum:ⁱF00A9243706F4154

GO

Isoform 2 (identifier: Q9NZH8-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I

« Hide

        10         20         30         40         50
MRGTPGDADG GGRAVYQSIT VAVITCKYPE ALEQGRGDPI YLGIQNPEMC 
        60         70         80         90        100
LYCEKVGEQP TLQLKEQKIM DLYGQPEPVK PFLFYRAKTG RTSTLESVAF 
       110        120        130 
PDWFIASSKR DQPIILTSEL GKSYNTAFEL NIND

Note: No experimental confirmation available.

Show »

Length:134

Mass (Da):14,928

Checksum:ⁱD5369C5AD44A9752

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	C9J681	C9J681_HUMAN		Interleukin-36 gamma Interleukin-36 gamma	IL36G	38	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_024505	69	Q → K. Corresponds to variant dbSNP:rs6707930Ensembl.		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_013002	19 – 54	MCKPI…SVTPV → I in isoform 2. 1 PublicationAdd BLAST		36

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF200492 mRNA Translation: AAF69248.1 AF206696 mRNA Translation: AAG35670.1 BN000002 Genomic DNA Translation: CAD29874.1 AY359111 mRNA Translation: AAQ89469.1 AY968311 Genomic DNA Translation: AAX59035.1 AC016724 Genomic DNA Translation: AAY14987.1 BC096721 mRNA Translation: AAH96721.1 BC098130 mRNA Translation: AAH98130.1 BC098155 mRNA Translation: AAH98155.1 BC098337 mRNA Translation: AAH98337.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2108.1 [Q9NZH8-1] CCDS62992.1 [Q9NZH8-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001265497.1, NM_001278568.1 [Q9NZH8-2] NP_062564.1, NM_019618.3 [Q9NZH8-1]
UniGeneⁱ	Hs.211238

Genome annotation databases

Ensemblⁱ	ENST00000259205; ENSP00000259205; ENSG00000136688 [Q9NZH8-1] ENST00000376489; ENSP00000365672; ENSG00000136688 [Q9NZH8-2]
GeneIDⁱ	56300
KEGGⁱ	hsa:56300
UCSC genome browser More...UCSCⁱ	uc002tio.3 human [Q9NZH8-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Protein	Similar proteins		Species	Score	Length	Source
Q9NZH8	Interleukin-36 gamma (Fragment)		HUMAN		38	UniRef100_Q9NZH8
UPI00018C5F4A		HUMAN		152

Protein	Similar proteins		Species	Score	Length	Source
Q9NZH8	Interleukin-36 gamma (Fragment)		HUMAN		38	UniRef90_Q9NZH8
Interleukin-1		PANTR		169
Interleukin-1		PANPA		169
Interleukin-1		PONAB		169
Interleukin-1		GORGO		169
+3
Q9NZH8-2	Interleukin-1		PANTR		134	UniRef90_Q9NZH8-2
Interleukin-1		COLAP		134
Interleukin-1		PONAB		134
Interleukin-1		GORGO		134

Protein	Similar proteins		Species	Score	Length	Source
Q9NZH8	Interleukin-36 gamma (Fragment)		HUMAN		38	UniRef50_Q9NZH8
Interleukin-1		PANTR		169
Interleukin-1		PANPA		169
Interleukin-1		GORGO		169
Interleukin-1		PONAB		169
+18
Q9NZH8-2	Interleukin-1		PONAB		134	UniRef50_Q9NZH8-2
Interleukin-1		COLAP		134
Interleukin-1		GORGO		134
Interleukin-1		PANTR		134
Interleukin-1		NOMLE		134
+12

Cross-referencesⁱ

Web resourcesⁱ

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF200492 mRNA Translation: AAF69248.1 AF206696 mRNA Translation: AAG35670.1 BN000002 Genomic DNA Translation: CAD29874.1 AY359111 mRNA Translation: AAQ89469.1 AY968311 Genomic DNA Translation: AAX59035.1 AC016724 Genomic DNA Translation: AAY14987.1 BC096721 mRNA Translation: AAH96721.1 BC098130 mRNA Translation: AAH98130.1 BC098155 mRNA Translation: AAH98155.1 BC098337 mRNA Translation: AAH98337.1
CCDSⁱ	CCDS2108.1 [Q9NZH8-1] CCDS62992.1 [Q9NZH8-2]
RefSeqⁱ	NP_001265497.1, NM_001278568.1 [Q9NZH8-2] NP_062564.1, NM_019618.3 [Q9NZH8-1]
UniGeneⁱ	Hs.211238

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	4IZE	X-ray	2.00	A	18-169	[»]
	4P0J	X-ray	2.30	A/B	154-160	[»]
	4P0K	X-ray	1.70	A	64-72	[»]
				A	154-160	[»]
	4P0L	X-ray	1.55	A	64-72	[»]
				A	154-160	[»]
ProteinModelPortalⁱ	Q9NZH8
SMRⁱ	Q9NZH8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	121135, 8 interactors
STRINGⁱ	9606.ENSP00000259205

PTM databases

iPTMnetⁱ	Q9NZH8
PhosphoSitePlusⁱ	Q9NZH8

Proteomic databases

EPDⁱ	Q9NZH8
PaxDbⁱ	Q9NZH8
PeptideAtlasⁱ	Q9NZH8
PRIDEⁱ	Q9NZH8
ProteomicsDBⁱ	83397 83398 [Q9NZH8-2]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000259205; ENSP00000259205; ENSG00000136688 [Q9NZH8-1] ENST00000376489; ENSP00000365672; ENSG00000136688 [Q9NZH8-2]
GeneIDⁱ	56300
KEGGⁱ	hsa:56300
UCSCⁱ	uc002tio.3 human [Q9NZH8-1]

Organism-specific databases

CTDⁱ	56300
DisGeNETⁱ	56300
EuPathDBⁱ	HostDB:ENSG00000136688.10
GeneCardsⁱ	IL36G
HGNCⁱ	HGNC:15741 IL36G
MIMⁱ	605542 gene
neXtProtⁱ	NX_Q9NZH8
OpenTargetsⁱ	ENSG00000136688
PharmGKBⁱ	PA38395
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410J1V3 Eukaryota ENOG4111C31 LUCA
GeneTreeⁱ	ENSGT00900000141014
HOVERGENⁱ	HBG052100
InParanoidⁱ	Q9NZH8
KOⁱ	K05487
OMAⁱ	PFLFYRV
OrthoDBⁱ	EOG091G0V8E
PhylomeDBⁱ	Q9NZH8
TreeFamⁱ	TF300203

Enzyme and pathway databases

Reactomeⁱ	R-HSA-9014826 Interleukin-36 pathway
SignaLinkⁱ	Q9NZH8

Miscellaneous databases

GeneWikiⁱ	IL1F9
GenomeRNAiⁱ	56300
Protein Ontology More...PROⁱ	PR:Q9NZH8
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000136688 Expressed in 63 organ(s), highest expression level in periodontal ligament
CleanExⁱ	HS_IL1F9
ExpressionAtlasⁱ	Q9NZH8 baseline and differential
Genevisibleⁱ	Q9NZH8 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR000975 IL-1_fam IPR003297 IL-1RA/IL-36 IPR008996 IL1/FGF
Pfamⁱ	View protein in Pfam PF00340 IL1, 1 hit
PRINTSⁱ	PR00264 INTERLEUKIN1 PR01360 INTRLEUKIN1X
SUPFAMⁱ	SSF50353 SSF50353, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	IL36G_HUMAN
Accessionⁱ	Q9NZH8Primary (citable) accession number: Q9NZH8 Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 8, 2002
	Last sequence update:	October 1, 2000
	Last modified:	November 7, 2018
	This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9NZH8 (IL36G_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Interleukin-36 gamma

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Extracellular region or secreted

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ