Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-36 gamma

Gene

IL36G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.6 Publications

GO - Molecular functioni

  • cytokine activity Source: GO_Central
  • interleukin-1 receptor binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionCytokine
Biological processImmunity, Inflammatory response, Innate immunity

Enzyme and pathway databases

ReactomeiR-HSA-9014826 Interleukin-36 pathway
SignaLinkiQ9NZH8

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-36 gamma
Alternative name(s):
IL-1-related protein 2
Short name:
IL-1RP2
Interleukin-1 epsilon
Short name:
IL-1 epsilon
Interleukin-1 family member 9
Short name:
IL-1F9
Interleukin-1 homolog 1
Short name:
IL-1H1
Gene namesi
Name:IL36G
Synonyms:IL1E, IL1F9, IL1H1, IL1RP2
ORF Names:UNQ2456/PRO5737
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000136688.10
HGNCiHGNC:15741 IL36G
MIMi605542 gene
neXtProtiNX_Q9NZH8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi56300
OpenTargetsiENSG00000136688
PharmGKBiPA38395

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
PropeptideiPRO_00004305491 – 171 PublicationAdd BLAST17
ChainiPRO_000015364818 – 169Interleukin-36 gammaAdd BLAST152

Post-translational modificationi

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).1 Publication

Proteomic databases

EPDiQ9NZH8
PaxDbiQ9NZH8
PeptideAtlasiQ9NZH8
PRIDEiQ9NZH8
ProteomicsDBi83397
83398 [Q9NZH8-2]

PTM databases

iPTMnetiQ9NZH8
PhosphoSitePlusiQ9NZH8

Expressioni

Tissue specificityi

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.2 Publications

Inductioni

By TNF and by IFNG/IFN-gamma in keratinocytes. By Aspergillus fumigatus conidia in peripheral blood mnonocytes; involves CLEC7A and SYK.2 Publications

Gene expression databases

BgeeiENSG00000136688 Expressed in 63 organ(s), highest expression level in periodontal ligament
CleanExiHS_IL1F9
ExpressionAtlasiQ9NZH8 baseline and differential
GenevisibleiQ9NZH8 HS

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121135, 8 interactors
STRINGi9606.ENSP00000259205

Structurei

Secondary structure

1169
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NZH8
SMRiQ9NZH8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

eggNOGiENOG410J1V3 Eukaryota
ENOG4111C31 LUCA
GeneTreeiENSGT00900000141014
HOVERGENiHBG052100
InParanoidiQ9NZH8
KOiK05487
OMAiPFLFYRV
OrthoDBiEOG091G0V8E
PhylomeDBiQ9NZH8
TreeFamiTF300203

Family and domain databases

InterProiView protein in InterPro
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF
PfamiView protein in Pfam
PF00340 IL1, 1 hit
PRINTSiPR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X
SUPFAMiSSF50353 SSF50353, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZH8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS
60 70 80 90 100
VTPVTVAVIT CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK
110 120 130 140 150
EQKIMDLYGQ PEPVKPFLFY RAKTGRTSTL ESVAFPDWFI ASSKRDQPII
160
LTSELGKSYN TAFELNIND
Length:169
Mass (Da):18,721
Last modified:October 1, 2000 - v1
Checksum:iF00A9243706F4154
GO
Isoform 2 (identifier: Q9NZH8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):14,928
Checksum:iD5369C5AD44A9752
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J681C9J681_HUMAN
Interleukin-36 gamma
IL36G
38Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02450569Q → K. Corresponds to variant dbSNP:rs6707930Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01300219 – 54MCKPI…SVTPV → I in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200492 mRNA Translation: AAF69248.1
AF206696 mRNA Translation: AAG35670.1
BN000002 Genomic DNA Translation: CAD29874.1
AY359111 mRNA Translation: AAQ89469.1
AY968311 Genomic DNA Translation: AAX59035.1
AC016724 Genomic DNA Translation: AAY14987.1
BC096721 mRNA Translation: AAH96721.1
BC098130 mRNA Translation: AAH98130.1
BC098155 mRNA Translation: AAH98155.1
BC098337 mRNA Translation: AAH98337.1
CCDSiCCDS2108.1 [Q9NZH8-1]
CCDS62992.1 [Q9NZH8-2]
RefSeqiNP_001265497.1, NM_001278568.1 [Q9NZH8-2]
NP_062564.1, NM_019618.3 [Q9NZH8-1]
UniGeneiHs.211238

Genome annotation databases

EnsembliENST00000259205; ENSP00000259205; ENSG00000136688 [Q9NZH8-1]
ENST00000376489; ENSP00000365672; ENSG00000136688 [Q9NZH8-2]
GeneIDi56300
KEGGihsa:56300
UCSCiuc002tio.3 human [Q9NZH8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200492 mRNA Translation: AAF69248.1
AF206696 mRNA Translation: AAG35670.1
BN000002 Genomic DNA Translation: CAD29874.1
AY359111 mRNA Translation: AAQ89469.1
AY968311 Genomic DNA Translation: AAX59035.1
AC016724 Genomic DNA Translation: AAY14987.1
BC096721 mRNA Translation: AAH96721.1
BC098130 mRNA Translation: AAH98130.1
BC098155 mRNA Translation: AAH98155.1
BC098337 mRNA Translation: AAH98337.1
CCDSiCCDS2108.1 [Q9NZH8-1]
CCDS62992.1 [Q9NZH8-2]
RefSeqiNP_001265497.1, NM_001278568.1 [Q9NZH8-2]
NP_062564.1, NM_019618.3 [Q9NZH8-1]
UniGeneiHs.211238

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4IZEX-ray2.00A18-169[»]
4P0JX-ray2.30A/B154-160[»]
4P0KX-ray1.70A64-72[»]
A154-160[»]
4P0LX-ray1.55A64-72[»]
A154-160[»]
ProteinModelPortaliQ9NZH8
SMRiQ9NZH8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121135, 8 interactors
STRINGi9606.ENSP00000259205

PTM databases

iPTMnetiQ9NZH8
PhosphoSitePlusiQ9NZH8

Proteomic databases

EPDiQ9NZH8
PaxDbiQ9NZH8
PeptideAtlasiQ9NZH8
PRIDEiQ9NZH8
ProteomicsDBi83397
83398 [Q9NZH8-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000259205; ENSP00000259205; ENSG00000136688 [Q9NZH8-1]
ENST00000376489; ENSP00000365672; ENSG00000136688 [Q9NZH8-2]
GeneIDi56300
KEGGihsa:56300
UCSCiuc002tio.3 human [Q9NZH8-1]

Organism-specific databases

CTDi56300
DisGeNETi56300
EuPathDBiHostDB:ENSG00000136688.10
GeneCardsiIL36G
HGNCiHGNC:15741 IL36G
MIMi605542 gene
neXtProtiNX_Q9NZH8
OpenTargetsiENSG00000136688
PharmGKBiPA38395
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J1V3 Eukaryota
ENOG4111C31 LUCA
GeneTreeiENSGT00900000141014
HOVERGENiHBG052100
InParanoidiQ9NZH8
KOiK05487
OMAiPFLFYRV
OrthoDBiEOG091G0V8E
PhylomeDBiQ9NZH8
TreeFamiTF300203

Enzyme and pathway databases

ReactomeiR-HSA-9014826 Interleukin-36 pathway
SignaLinkiQ9NZH8

Miscellaneous databases

GeneWikiiIL1F9
GenomeRNAii56300
PROiPR:Q9NZH8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000136688 Expressed in 63 organ(s), highest expression level in periodontal ligament
CleanExiHS_IL1F9
ExpressionAtlasiQ9NZH8 baseline and differential
GenevisibleiQ9NZH8 HS

Family and domain databases

InterProiView protein in InterPro
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF
PfamiView protein in Pfam
PF00340 IL1, 1 hit
PRINTSiPR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X
SUPFAMiSSF50353 SSF50353, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiIL36G_HUMAN
AccessioniPrimary (citable) accession number: Q9NZH8
Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again