Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZH6 (IL37_HUMAN)

Protein

Interleukin-37

Gene

IL37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cytokine activity Source: GO_Central
  • interleukin-1 receptor binding Source: GO_Central
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9008059 Interleukin-37 signaling
R-HSA-9012546 Interleukin-18 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-37
Alternative name(s):
FIL1 zeta
IL-1X
Interleukin-1 family member 7
Short name:
IL-1F7
Interleukin-1 homolog 4
Short name:
IL-1H
Short name:
IL-1H4
Interleukin-1 zeta
Short name:
IL-1 zeta
Interleukin-1-related protein
Short name:
IL-1RP1
Interleukin-23
Short name:
IL-37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL37
Synonyms:FIL1Z, IL1F7, IL1H4, IL1RP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000125571.9

Human Gene Nomenclature Database

More...HGNCi		HGNC:15563 IL37

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605510 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZH6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		27178

Open Targets

More...OpenTargetsi		ENSG00000125571

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38390

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		IL37

Domain mapping of disease mutations (DMDM)

More...DMDMi		25008593

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000153351 – 45Removed in mature form1 PublicationAdd BLAST45
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001533646 – 218Interleukin-37Add BLAST173

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically converted to the mature form by CASP1.

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZH6

PeptideAtlas

More...PeptideAtlasi		Q9NZH6

PRoteomics IDEntifications database

More...PRIDEi		Q9NZH6

ProteomicsDB human proteome resource

More...ProteomicsDBi		83390
83391 [Q9NZH6-2]
83392 [Q9NZH6-3]
83393 [Q9NZH6-4]
83394 [Q9NZH6-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NZH6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NZH6

Miscellaneous databases

CutDB - Proteolytic event database

More...PMAP-CutDBi		Q9NZH6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Highly induced by bacterial lipopolysaccharides (LPS) and TGFB1, more moderately by IFNG, IL18, IL1B, TNF and the dinucleotide CpG (at protein level). Constitutive expression in bone marrow macrophages is down-regulated in the presence of IL4 and CSF2. Induced by phorbol myristate acetate (PMA) in different cell lines.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125571 Expressed in 143 organ(s), highest expression level in skin of leg

CleanEx database of gene expression profiles

More...CleanExi		HS_IL1F7

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZH6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA054371
HPA057950

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SMAD3. Binds IL18R1, but not to IL1R1, with lower affinity than IL18, and does not seem to act as a receptor antagonist for IL18.2 Publications

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		118054, 12 interactors

Protein interaction database and analysis system

More...IntActi		Q9NZH6, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000263326

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1218
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9NZH6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZH6

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410J8RD Eukaryota
ENOG41118IW LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00900000141014

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG052101

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZH6

KEGG Orthology (KO)

More...KOi		K05485

Identification of Orthologs from Complete Genome Data

More...OMAi		RKHTEFS

Database of Orthologous Groups

More...OrthoDBi		EOG091G0J3H

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZH6

TreeFam database of animal gene trees

More...TreeFami		TF300203

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00340 IL1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50353 SSF50353, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: Q9NZH6-1) [UniParc]FASTAAdd to basket
Also known as: IL-1F7b, IL-HLa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFVGENSGV KMGSEDWEKD EPQCCLEDPA GSPLEPGPSL PTMNFVHTSP 
        60         70         80         90        100
KVKNLNPKKF SIHDQDHKVL VLDSGNLIAV PDKNYIRPEI FFALASSLSS 
       110        120        130        140        150
ASAEKGSPIL LGVSKGEFCL YCDKDKGQSH PSLQLKKEKL MKLAAQKESA 
       160        170        180        190        200
RRPFIFYRAQ VGSWNMLESA AHPGWFICTS CNCNEPVGVT DKFENRKHIE 
       210 
FSFQPVCKAE MSPSEVSD
Note: The name IL-HL refers to isoform B containing polymorphisms Val-31 and Ala-42.1 Publication
Length:218
Mass (Da):24,126
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i96E089310D2CEA68
GO
Isoform A (identifier: Q9NZH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTS → MSGCDRRETETKGKNSFKKRLRG

Show »
Length:192
Mass (Da):21,543
Checksum:i4AF584C81802F612
GO
Isoform C (identifier: Q9NZH6-3) [UniParc]FASTAAdd to basket
Also known as: IL-HS

The sequence of this isoform differs from the canonical sequence as follows:
     49-89: SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE → K

Show »
Length:178
Mass (Da):19,604
Checksum:iD9BE1DD4858C4932
GO
Isoform D (identifier: Q9NZH6-4) [UniParc]FASTAAdd to basket
Also known as: IL1F7d

The sequence of this isoform differs from the canonical sequence as follows:
     28-49: DPAGSPLEPGPSLPTMNFVHTS → G

Show »
Length:197
Mass (Da):21,950
Checksum:i55BEA6540008B67A
GO
Isoform E (identifier: Q9NZH6-5) [UniParc]FASTAAdd to basket
Also known as: IL1F7e

The sequence of this isoform differs from the canonical sequence as follows:
     28-88: Missing.

Show »
Length:157
Mass (Da):17,459
Checksum:i5EA5EA10CF309086
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01426031G → V3 PublicationsCorresponds to variant dbSNP:rs3811046Ensembl.1
Natural variantiVAR_01426142T → A3 PublicationsCorresponds to variant dbSNP:rs3811047Ensembl.1
Natural variantiVAR_04957450P → R. Corresponds to variant dbSNP:rs2708943Ensembl.1
Natural variantiVAR_04957554N → S. Corresponds to variant dbSNP:rs2723183Ensembl.1
Natural variantiVAR_023334108P → L1 PublicationCorresponds to variant dbSNP:rs2723187Ensembl.1
Natural variantiVAR_023335152R → W1 PublicationCorresponds to variant dbSNP:rs28947200Ensembl.1
Natural variantiVAR_023336164W → R1 PublicationCorresponds to variant dbSNP:rs2708947Ensembl.1
Natural variantiVAR_023337218D → N1 PublicationCorresponds to variant dbSNP:rs2723192Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0026531 – 49MSFVG…FVHTS → MSGCDRRETETKGKNSFKKR LRG in isoform A. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_00265528 – 88Missing in isoform E. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_00265428 – 49DPAGS…FVHTS → G in isoform D. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_00265649 – 89SPKVK…YIRPE → K in isoform C. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF200496 mRNA Translation: AAF69252.1
AF167368 mRNA Translation: AAG29344.1
AF251118 mRNA Translation: AAG14420.1
AF251119 mRNA Translation: AAG14421.1
AF251120 mRNA Translation: AAG14422.1
AF201832 mRNA Translation: AAF25212.1
AY071840 mRNA Translation: AAL67151.1
AY071841 mRNA Translation: AAL67154.1
AY973625 Genomic DNA Translation: AAX59036.1
AB451333 mRNA Translation: BAG70147.1
AB451478 mRNA Translation: BAG70292.1
AC079753 Genomic DNA Translation: AAX88889.1
CH471217 Genomic DNA Translation: EAW73609.1
BC020637 mRNA Translation: AAH20637.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2103.1 [Q9NZH6-1]
CCDS2104.1 [Q9NZH6-4]
CCDS2105.1 [Q9NZH6-5]
CCDS2106.1 [Q9NZH6-3]
CCDS2107.1 [Q9NZH6-2]

NCBI Reference Sequences

More...RefSeqi		NP_055254.2, NM_014439.3 [Q9NZH6-1]
NP_775294.1, NM_173202.1 [Q9NZH6-4]
NP_775295.1, NM_173203.1 [Q9NZH6-5]
NP_775296.1, NM_173204.1 [Q9NZH6-3]
NP_775297.1, NM_173205.1 [Q9NZH6-2]
XP_011509265.1, XM_011510963.2 [Q9NZH6-1]
XP_011509266.1, XM_011510964.2 [Q9NZH6-3]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.166371

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000263326; ENSP00000263326; ENSG00000125571 [Q9NZH6-1]
ENST00000311328; ENSP00000309883; ENSG00000125571 [Q9NZH6-2]
ENST00000349806; ENSP00000263328; ENSG00000125571 [Q9NZH6-5]
ENST00000352179; ENSP00000263327; ENSG00000125571 [Q9NZH6-4]
ENST00000353225; ENSP00000309208; ENSG00000125571 [Q9NZH6-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		27178

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:27178

UCSC genome browser

More...UCSCi		uc002tij.4 human [Q9NZH6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200496 mRNA Translation: AAF69252.1
AF167368 mRNA Translation: AAG29344.1
AF251118 mRNA Translation: AAG14420.1
AF251119 mRNA Translation: AAG14421.1
AF251120 mRNA Translation: AAG14422.1
AF201832 mRNA Translation: AAF25212.1
AY071840 mRNA Translation: AAL67151.1
AY071841 mRNA Translation: AAL67154.1
AY973625 Genomic DNA Translation: AAX59036.1
AB451333 mRNA Translation: BAG70147.1
AB451478 mRNA Translation: BAG70292.1
AC079753 Genomic DNA Translation: AAX88889.1
CH471217 Genomic DNA Translation: EAW73609.1
BC020637 mRNA Translation: AAH20637.1
CCDSiCCDS2103.1 [Q9NZH6-1]
CCDS2104.1 [Q9NZH6-4]
CCDS2105.1 [Q9NZH6-5]
CCDS2106.1 [Q9NZH6-3]
CCDS2107.1 [Q9NZH6-2]
RefSeqiNP_055254.2, NM_014439.3 [Q9NZH6-1]
NP_775294.1, NM_173202.1 [Q9NZH6-4]
NP_775295.1, NM_173203.1 [Q9NZH6-5]
NP_775296.1, NM_173204.1 [Q9NZH6-3]
NP_775297.1, NM_173205.1 [Q9NZH6-2]
XP_011509265.1, XM_011510963.2 [Q9NZH6-1]
XP_011509266.1, XM_011510964.2 [Q9NZH6-3]
UniGeneiHs.166371

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5HN1X-ray2.25A/B46-218[»]
ProteinModelPortaliQ9NZH6
SMRiQ9NZH6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118054, 12 interactors
IntActiQ9NZH6, 3 interactors
STRINGi9606.ENSP00000263326

PTM databases

iPTMnetiQ9NZH6
PhosphoSitePlusiQ9NZH6

Polymorphism and mutation databases

BioMutaiIL37
DMDMi25008593

Proteomic databases

PaxDbiQ9NZH6
PeptideAtlasiQ9NZH6
PRIDEiQ9NZH6
ProteomicsDBi83390
83391 [Q9NZH6-2]
83392 [Q9NZH6-3]
83393 [Q9NZH6-4]
83394 [Q9NZH6-5]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		27178
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263326; ENSP00000263326; ENSG00000125571 [Q9NZH6-1]
ENST00000311328; ENSP00000309883; ENSG00000125571 [Q9NZH6-2]
ENST00000349806; ENSP00000263328; ENSG00000125571 [Q9NZH6-5]
ENST00000352179; ENSP00000263327; ENSG00000125571 [Q9NZH6-4]
ENST00000353225; ENSP00000309208; ENSG00000125571 [Q9NZH6-3]
GeneIDi27178
KEGGihsa:27178
UCSCiuc002tij.4 human [Q9NZH6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27178
DisGeNETi27178
EuPathDBiHostDB:ENSG00000125571.9

GeneCards: human genes, protein and diseases

More...GeneCardsi		IL37
HGNCiHGNC:15563 IL37
HPAiHPA054371
HPA057950
MIMi605510 gene
neXtProtiNX_Q9NZH6
OpenTargetsiENSG00000125571
PharmGKBiPA38390

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410J8RD Eukaryota
ENOG41118IW LUCA
GeneTreeiENSGT00900000141014
HOVERGENiHBG052101
InParanoidiQ9NZH6
KOiK05485
OMAiRKHTEFS
OrthoDBiEOG091G0J3H
PhylomeDBiQ9NZH6
TreeFamiTF300203

Enzyme and pathway databases

ReactomeiR-HSA-9008059 Interleukin-37 signaling
R-HSA-9012546 Interleukin-18 signaling

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		IL1F7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		27178
PMAP-CutDBiQ9NZH6

Protein Ontology

More...PROi		PR:Q9NZH6

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125571 Expressed in 143 organ(s), highest expression level in skin of leg
CleanExiHS_IL1F7
GenevisibleiQ9NZH6 HS

Family and domain databases

InterProiView protein in InterPro
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF
PfamiView protein in Pfam
PF00340 IL1, 1 hit
PRINTSiPR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X
SUPFAMiSSF50353 SSF50353, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL37_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZH6
Secondary accession number(s): B5BU97
, Q56AP9, Q8TD04, Q8TD05, Q9HBF2, Q9HBF3, Q9UHA6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 153 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again