Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (16 Oct 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

G-protein coupled receptor family C group 5 member D

Gene

GPRC5D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
G-protein coupled receptor family C group 5 member D
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPRC5D
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13310 GPRC5D

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607437 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NZD1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 27ExtracellularSequence analysisAdd BLAST27
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei28 – 48Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini49 – 63CytoplasmicSequence analysisAdd BLAST15
Transmembranei64 – 84Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini85 – 93ExtracellularSequence analysis9
Transmembranei94 – 114Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini115 – 123CytoplasmicSequence analysis9
Transmembranei124 – 144Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini145 – 167ExtracellularSequence analysisAdd BLAST23
Transmembranei168 – 188Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini189 – 204CytoplasmicSequence analysisAdd BLAST16
Transmembranei205 – 225Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini226 – 239ExtracellularSequence analysisAdd BLAST14
Transmembranei240 – 260Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini261 – 345CytoplasmicSequence analysisAdd BLAST85

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55507

Open Targets

More...
OpenTargetsi
ENSG00000111291

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28940

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NZD1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GPRC5D

Domain mapping of disease mutations (DMDM)

More...
DMDMi
46396015

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002068971 – 345G-protein coupled receptor family C group 5 member DAdd BLAST345

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NZD1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NZD1

PeptideAtlas

More...
PeptideAtlasi
Q9NZD1

PRoteomics IDEntifications database

More...
PRIDEi
Q9NZD1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83372 [Q9NZD1-1]
83373 [Q9NZD1-2]
83374 [Q9NZD1-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NZD1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NZD1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111291 Expressed in 84 organ(s), highest expression level in hair follicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NZD1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NZD1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA071909

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q8TAF84EBI-13067820,EBI-2820517

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120687, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NZD1, 25 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000228887

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK8H Eukaryota
ENOG411157H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182961

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000116197

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NZD1

KEGG Orthology (KO)

More...
KOi
K04621

Identification of Orthologs from Complete Genome Data

More...
OMAi
RSCKQDC

Database of Orthologous Groups

More...
OrthoDBi
807909at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NZD1

TreeFam database of animal gene trees

More...
TreeFami
TF321410

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017978 GPCR_3_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00003 7tm_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NZD1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYKDCIESTG DYFLLCDAEG PWGIILESLA ILGIVVTILL LLAFLFLMRK
60 70 80 90 100
IQDCSQWNVL PTQLLFLLSV LGLFGLAFAF IIELNQQTAP VRYFLFGVLF
110 120 130 140 150
ALCFSCLLAH ASNLVKLVRG CVSFSWTTIL CIAIGCSLLQ IIIATEYVTL
160 170 180 190 200
IMTRGMMFVN MTPCQLNVDF VVLLVYVLFL MALTFFVSKA TFCGPCENWK
210 220 230 240 250
QHGRLIFITV LFSIIIWVVW ISMLLRGNPQ FQRQPQWDDP VVCIALVTNA
260 270 280 290 300
WVFLLLYIVP ELCILYRSCR QECPLQGNAC PVTAYQHSFQ VENQELSRAR
310 320 330 340
DSDGAEEDVA LTSYGTPIQP QTVDPTQECF IPQAKLSPQQ DAGGV
Length:345
Mass (Da):38,791
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i14B09E4C5E9F9B49
GO
Isoform 2 (identifier: Q9NZD1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-300: AR → DC
     301-345: Missing.

Show »
Length:300
Mass (Da):34,095
Checksum:iDC99870AB178A061
GO
Isoform 3 (identifier: Q9NZD1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG

Show »
Length:323
Mass (Da):36,559
Checksum:iFEF5CB0A1066B28E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GWX9F5GWX9_HUMAN
G-protein-coupled receptor family C...
GPRC5D
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01829718A → D. Corresponds to variant dbSNP:rs3741822Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010008299 – 345ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3. CuratedAdd BLAST47
Alternative sequenceiVSP_010006299 – 300AR → DC in isoform 2. 1 Publication2
Alternative sequenceiVSP_010007301 – 345Missing in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF209923 mRNA Translation: AAF72873.1
AB099817 mRNA Translation: BAC79169.1
AB083629 Genomic DNA Translation: BAB89342.1
BC069341 mRNA Translation: AAH69341.1
BC107077 mRNA Translation: AAI07078.1
BC107078 mRNA Translation: AAI07079.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8658.1 [Q9NZD1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_061124.1, NM_018654.1 [Q9NZD1-1]
XP_005253478.1, XM_005253421.3 [Q9NZD1-1]
XP_016875071.1, XM_017019582.1 [Q9NZD1-1]
XP_016875072.1, XM_017019583.1 [Q9NZD1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000228887; ENSP00000228887; ENSG00000111291 [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291 [Q9NZD1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55507

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55507

UCSC genome browser

More...
UCSCi
uc010shp.2 human [Q9NZD1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF209923 mRNA Translation: AAF72873.1
AB099817 mRNA Translation: BAC79169.1
AB083629 Genomic DNA Translation: BAB89342.1
BC069341 mRNA Translation: AAH69341.1
BC107077 mRNA Translation: AAI07078.1
BC107078 mRNA Translation: AAI07079.1
CCDSiCCDS8658.1 [Q9NZD1-1]
RefSeqiNP_061124.1, NM_018654.1 [Q9NZD1-1]
XP_005253478.1, XM_005253421.3 [Q9NZD1-1]
XP_016875071.1, XM_017019582.1 [Q9NZD1-1]
XP_016875072.1, XM_017019583.1 [Q9NZD1-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120687, 3 interactors
IntActiQ9NZD1, 25 interactors
STRINGi9606.ENSP00000228887

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiQ9NZD1
PhosphoSitePlusiQ9NZD1

Polymorphism and mutation databases

BioMutaiGPRC5D
DMDMi46396015

Proteomic databases

MassIVEiQ9NZD1
PaxDbiQ9NZD1
PeptideAtlasiQ9NZD1
PRIDEiQ9NZD1
ProteomicsDBi83372 [Q9NZD1-1]
83373 [Q9NZD1-2]
83374 [Q9NZD1-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55507

Genome annotation databases

EnsembliENST00000228887; ENSP00000228887; ENSG00000111291 [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291 [Q9NZD1-2]
GeneIDi55507
KEGGihsa:55507
UCSCiuc010shp.2 human [Q9NZD1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55507
DisGeNETi55507

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GPRC5D
HGNCiHGNC:13310 GPRC5D
HPAiHPA071909
MIMi607437 gene
neXtProtiNX_Q9NZD1
OpenTargetsiENSG00000111291
PharmGKBiPA28940

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IK8H Eukaryota
ENOG411157H LUCA
GeneTreeiENSGT00950000182961
HOGENOMiHOG000116197
InParanoidiQ9NZD1
KOiK04621
OMAiRSCKQDC
OrthoDBi807909at2759
PhylomeDBiQ9NZD1
TreeFamiTF321410

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GPRC5D

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55507
PharosiQ9NZD1

Protein Ontology

More...
PROi
PR:Q9NZD1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111291 Expressed in 84 organ(s), highest expression level in hair follicle
ExpressionAtlasiQ9NZD1 baseline and differential
GenevisibleiQ9NZD1 HS

Family and domain databases

InterProiView protein in InterPro
IPR017978 GPCR_3_C
PfamiView protein in Pfam
PF00003 7tm_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGPC5D_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZD1
Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 1, 2000
Last modified: October 16, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again