Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NZ52 (GGA3_HUMAN)

Entry version 211 (02 Jun 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

ADP-ribosylation factor-binding protein GGA3

Gene

GGA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (DXXLL) motif (PubMed:11301005).

Mediates export of the GPCR receptor ADRA2B to the cell surface (PubMed:26811329).

nvolved in BACE1 transport and sorting as well as regulation of BACE1 protein levels (PubMed:17553422, PubMed:15615712, PubMed:20484053).

Regulates retrograde transport of BACE1 from endosomes to the trans-Golgi network via interaction through the VHS motif and dependent of BACE1 phosphorylation (PubMed:15615712).

Modulates BACE1 protein levels independently of the interaction between VHS domain and DXXLL motif through recognition of ubiquitination (PubMed:20484053).

Key player in a novel DXXLL-mediated endosomal sorting machinery to the recycling pathway that targets NTRK1 to the plasma membrane (By similarity).

By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NZ52

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8854214, TBC/RABGAPs
R-HSA-8875656, MET receptor recycling
R-HSA-977225, Amyloid fiber formation

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.278.1.3, the organellar-targeting adaptor protein complex (o-apc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ADP-ribosylation factor-binding protein GGA3Curated
Alternative name(s):
Golgi-localized, gamma ear-containing, ARF-binding protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GGA3Imported
Synonyms:KIAA0154
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:17079, GGA3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606006, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NZ52

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000125447.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endosome, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi91N → A: No effect on regulation of BACE1 degradation. 1 Publication1
Mutagenesisi194N → A: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi199S → P: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi217T → P: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi247L → P: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi258K → M: No effect. Confers an affinity to RABEP1 identical to GGA1; when associated with N-283. 1 Publication1
Mutagenesisi262L → S: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi276L → A: Loss of UBC-binding and ubiquitination. Abolishes binding to ubiquitin. Abolishes regulation of BACE1 degradation. No effect on interaction with NTRK1. 4 Publications1
Mutagenesisi276L → S: Loss of UBC-binding and ubiquitination. 2 Publications1
Mutagenesisi280L → R: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi283S → N: Can bind RABEP1. Confers an affinity to RABEP1 identical to GGA1; when associated with M-258. 1 Publication1
Mutagenesisi284D → G: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi293Y → H: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi313D → A: Acts as dominant negatif. Prevents proteolytic cleavage by CASP3; when associated with A-328, A-333 and A-428. 1 Publication1
Mutagenesisi328D → A: Prevents proteolytic cleavage by CASP3; when associated with A-313, A-333 and A-428. 1 Publication1
Mutagenesisi333D → A: Prevents proteolytic cleavage by CASP3; when associated with A-313, A-328 and A-428. 1 Publication1
Mutagenesisi391 – 395DEELL → AAAAA: Increased binding to IGF2R. 1 Publication5
Mutagenesisi428D → A: Prevents proteolytic cleavage by CASP3; when associated with A-313, A-328 and A-333. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		23163

Open Targets

More...OpenTargetsi		ENSG00000125447

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28659

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NZ52, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GGA3

Domain mapping of disease mutations (DMDM)

More...DMDMi		14548064

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002126841 – 723ADP-ribosylation factor-binding protein GGA3Add BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei159PhosphoserineCombined sources1
Modified residuei275PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CK2 and dephosphorylated by PP2A (By similarity). Phosphorylation of GGA3 allows the internal DXXLL motif to bind the VHS domain and to inhibit the recognition of cargo signals.By similarity
Ubiquitinated.1 Publication
Proteolytically cleaved during apoptosis by CASP3.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NZ52

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NZ52

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NZ52

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NZ52

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NZ52

PeptideAtlas

More...PeptideAtlasi		Q9NZ52

PRoteomics IDEntifications database

More...PRIDEi		Q9NZ52

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83324 [Q9NZ52-1]
83325 [Q9NZ52-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NZ52

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NZ52

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125447, Expressed in sural nerve and 223 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NZ52, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NZ52, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000125447, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (Probable).

Interacts with GGA1 and GGA2 (PubMed:14638859). Binds to clathrin and activated ARFs, such as ARF1, ARF5 and ARF6 (PubMed:11301005, PubMed:11950392). Binds RABEP1 and RABGEF1 (PubMed:12505986, PubMed:15143060).

Interacts with the membrane proteins M6PR/CD-MPR and IGF2R/CI-MPR and the accessory proteins SYNRG, EPN4, NECAP1, NECAP2 and AFTPH/aftiphilin (PubMed:10814529, PubMed:11387475, PubMed:12060753, PubMed:12213833, PubMed:14665628).

Interacts with TSG101 and UBC (PubMed:14660606, PubMed:15039775).

Interacts with ADRA2B (PubMed:26811329).

Interacts with NTRK1; the interaction is independent of NTRK1 activation and ubiquitination (PubMed:26446845).

Interacts (via VHS domain) with BACE1 (via DXXLL motif) (PubMed:14567678).

Curated15 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116775, 66 interactors

Database of interacting proteins

More...DIPi		DIP-31600N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q9NZ52

Protein interaction database and analysis system

More...IntActi		Q9NZ52, 29 interactors

Molecular INTeraction database

More...MINTi		Q9NZ52

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000438085

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NZ52, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NZ52

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NZ52

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 146VHSPROSITE-ProRule annotationAdd BLAST131
Domaini171 – 298GATPROSITE-ProRule annotationAdd BLAST128
Domaini594 – 715GAEPROSITE-ProRule annotationAdd BLAST122

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 313Binds to ARF1 (in long isoform)Add BLAST313
Regioni299 – 593Unstructured hingeAdd BLAST295
Regioni339 – 384DisorderedSequence analysisAdd BLAST46
Regioni428 – 464DisorderedSequence analysisAdd BLAST37

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi391 – 395DXXLL1 Publication5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi347 – 365Pro residuesSequence analysisAdd BLAST19
Compositional biasi366 – 384Polar residuesSequence analysisAdd BLAST19

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The VHS domain functions as a recognition module for sorting signals composed of an acidic cluster followed by two leucines (DXXLL motif).2 Publications
The GAT domain is responsible for interaction with ARF-GTP, UBC and RABEP1. Required for recruitment to the TGN it prevents ARF-GTP hydrolysis.
The unstructured hinge region contains clathrin-binding and an autoinhibitory (DXXLL) motifs.
The GAE domain binds accessory proteins regulating GGAs function.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GGA protein family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1087, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157333

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015010_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NZ52

Identification of Orthologs from Complete Genome Data

More...OMAi		DFQFEAS

Database of Orthologous Groups

More...OrthoDBi		594067at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NZ52

TreeFam database of animal gene trees

More...TreeFami		TF318574

Family and domain databases

Conserved Domains Database

More...CDDi		cd14240, GAT_GGA3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.58.160, 1 hit
1.25.40.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008152, Clathrin_a/b/g-adaptin_app_Ig
IPR013041, Clathrin_app_Ig-like_sf
IPR008942, ENTH_VHS
IPR008153, GAE_dom
IPR004152, GAT_dom
IPR044111, GAT_GGA3
IPR038425, GAT_sf
IPR027422, GGA3
IPR041198, GGA_N-GAT
IPR002014, VHS_dom

The PANTHER Classification System

More...PANTHERi		PTHR45905:SF3, PTHR45905:SF3, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02883, Alpha_adaptinC2, 1 hit
PF03127, GAT, 1 hit
PF18308, GGA_N-GAT, 1 hit
PF00790, VHS, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00809, Alpha_adaptinC2, 1 hit
SM00288, VHS, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48464, SSF48464, 1 hit
SSF49348, SSF49348, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50180, GAE, 1 hit
PS50909, GAT, 1 hit
PS50179, VHS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: Q9NZ52-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAEGESLE SWLNKATNPS NRQEDWEYII GFCDQINKEL EGPQIAVRLL 
        60         70         80         90        100
AHKIQSPQEW EALQALTVLE ACMKNCGRRF HNEVGKFRFL NELIKVVSPK 
       110        120        130        140        150
YLGDRVSEKV KTKVIELLYS WTMALPEEAK IKDAYHMLKR QGIVQSDPPI 
       160        170        180        190        200
PVDRTLIPSP PPRPKNPVFD DEEKSKLLAK LLKSKNPDDL QEANKLIKSM 
       210        220        230        240        250
VKEDEARIQK VTKRLHTLEE VNNNVRLLSE MLLHYSQEDS SDGDRELMKE 
       260        270        280        290        300
LFDQCENKRR TLFKLASETE DNDNSLGDIL QASDNLSRVI NSYKTIIEGQ 
       310        320        330        340        350
VINGEVATLT LPDSEGNSQC SNQGTLIDLA ELDTTNSLSS VLAPAPTPPS 
       360        370        380        390        400
SGIPILPPPP QASGPPRSRS SSQAEATLGP SSTSNALSWL DEELLCLGLA 
       410        420        430        440        450
DPAPNVPPKE SAGNSQWHLL QREQSDLDFF SPRPGTAACG ASDAPLLQPS 
       460        470        480        490        500
APSSSSSQAP LPPPFPAPVV PASVPAPSAG SSLFSTGVAP ALAPKVEPAV 
       510        520        530        540        550
PGHHGLALGN SALHHLDALD QLLEEAKVTS GLVKPTTSPL IPTTTPARPL 
       560        570        580        590        600
LPFSTGPGSP LFQPLSFQSQ GSPPKGPELS LASIHVPLES IKPSSALPVT 
       610        620        630        640        650
AYDKNGFRIL FHFAKECPPG RPDVLVVVVS MLNTAPLPVK SIVLQAAVPK 
       660        670        680        690        700
SMKVKLQPPS GTELSPFSPI QPPAAITQVM LLANPLKEKV RLRYKLTFAL 
       710        720 
GEQLSTEVGE VDQFPPVEQW GNL
Length:723
Mass (Da):78,315
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4F80D6032239168C
GO
Isoform Short (identifier: Q9NZ52-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-100: Missing.

Show »
Length:690
Mass (Da):74,470
Checksum:iE3A1C841AB3966C8
GO
Isoform 3 (identifier: Q9NZ52-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     688-723: EKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL → KQVLSFLGKACLQPWGQAILLTTSCLA

Show »
Length:592
Mass (Da):62,921
Checksum:iCACD3268CEE80BBE
GO
Isoform 4 (identifier: Q9NZ52-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Show »
Length:651
Mass (Da):70,148
Checksum:i416484203E34542A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KSS7J3KSS7_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
632Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSG3J3KSG3_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRK7J3QRK7_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS27J3KS27_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QS87J3QS87_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTR5J3KTR5_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRS8J3QRS8_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z1E9B7Z1E9_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRP3J3QRP3_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYN2A0A087WYN2_HUMAN
ADP-ribosylation factor-binding pro...
GGA3
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA09926 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti448Q → K in AAH70044 (PubMed:15489334).Curated1
Sequence conflicti562F → S in BAH13665 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_075715132K → R1 PublicationCorresponds to variant dbSNP:rs117805695Ensembl.1
Natural variantiVAR_075716321S → G1 PublicationCorresponds to variant dbSNP:rs146877619Ensembl.1
Natural variantiVAR_036524574P → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs776324450Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451331 – 122Missing in isoform 3. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_0468681 – 72Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_00174568 – 100Missing in isoform Short. 4 PublicationsAdd BLAST33
Alternative sequenceiVSP_045134688 – 723EKVRL…QWGNL → KQVLSFLGKACLQPWGQAIL LTTSCLA in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF219138 mRNA Translation: AAF42848.1
AF190864 mRNA Translation: AAF05709.1
AF219139 mRNA Translation: AAF42849.1
D63876 mRNA Translation: BAA09926.1 Different initiation.
AK301895 mRNA Translation: BAH13578.1
AK302278 mRNA Translation: BAH13665.1
AC022211 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89258.1
BC070044 mRNA Translation: AAH70044.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11716.1 [Q9NZ52-2]
CCDS11717.1 [Q9NZ52-1]
CCDS54164.1 [Q9NZ52-4]
CCDS58597.1 [Q9NZ52-3]

NCBI Reference Sequences

More...RefSeqi		NP_001166174.1, NM_001172703.2 [Q9NZ52-4]
NP_001166175.1, NM_001172704.2 [Q9NZ52-3]
NP_001278570.1, NM_001291641.1 [Q9NZ52-4]
NP_001278571.1, NM_001291642.1
NP_054720.1, NM_014001.4 [Q9NZ52-2]
NP_619525.1, NM_138619.3 [Q9NZ52-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000537686; ENSP00000438085; ENSG00000125447 [Q9NZ52-1]
ENST00000538886; ENSP00000446421; ENSG00000125447 [Q9NZ52-2]
ENST00000578348; ENSP00000463288; ENSG00000125447 [Q9NZ52-3]
ENST00000582717; ENSP00000462081; ENSG00000125447 [Q9NZ52-4]
ENST00000649398; ENSP00000496890; ENSG00000125447 [Q9NZ52-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23163

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23163

UCSC genome browser

More...UCSCi		uc010wrw.3, human [Q9NZ52-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF219138 mRNA Translation: AAF42848.1
AF190864 mRNA Translation: AAF05709.1
AF219139 mRNA Translation: AAF42849.1
D63876 mRNA Translation: BAA09926.1 Different initiation.
AK301895 mRNA Translation: BAH13578.1
AK302278 mRNA Translation: BAH13665.1
AC022211 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89258.1
BC070044 mRNA Translation: AAH70044.1
CCDSiCCDS11716.1 [Q9NZ52-2]
CCDS11717.1 [Q9NZ52-1]
CCDS54164.1 [Q9NZ52-4]
CCDS58597.1 [Q9NZ52-3]
RefSeqiNP_001166174.1, NM_001172703.2 [Q9NZ52-4]
NP_001166175.1, NM_001172704.2 [Q9NZ52-3]
NP_001278570.1, NM_001291641.1 [Q9NZ52-4]
NP_001278571.1, NM_001291642.1
NP_054720.1, NM_014001.4 [Q9NZ52-2]
NP_619525.1, NM_138619.3 [Q9NZ52-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JPLX-ray2.40A/B/C/D1-166[»]
1JUQX-ray2.20A/B/C/D1-166[»]
1LF8X-ray2.30A/B/C/D1-166[»]
1P4UX-ray2.20A571-723[»]
1WR6X-ray2.60A/B/C/D209-319[»]
1YD8X-ray2.80G/H208-301[»]
SMRiQ9NZ52
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116775, 66 interactors
DIPiDIP-31600N
ELMiQ9NZ52
IntActiQ9NZ52, 29 interactors
MINTiQ9NZ52
STRINGi9606.ENSP00000438085

Protein family/group databases

TCDBi9.B.278.1.3, the organellar-targeting adaptor protein complex (o-apc) family

PTM databases

iPTMnetiQ9NZ52
PhosphoSitePlusiQ9NZ52

Genetic variation databases

BioMutaiGGA3
DMDMi14548064

Proteomic databases

EPDiQ9NZ52
jPOSTiQ9NZ52
MassIVEiQ9NZ52
MaxQBiQ9NZ52
PaxDbiQ9NZ52
PeptideAtlasiQ9NZ52
PRIDEiQ9NZ52
ProteomicsDBi83324 [Q9NZ52-1]
83325 [Q9NZ52-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19520, 191 antibodies

The DNASU plasmid repository

More...DNASUi		23163

Genome annotation databases

EnsembliENST00000537686; ENSP00000438085; ENSG00000125447 [Q9NZ52-1]
ENST00000538886; ENSP00000446421; ENSG00000125447 [Q9NZ52-2]
ENST00000578348; ENSP00000463288; ENSG00000125447 [Q9NZ52-3]
ENST00000582717; ENSP00000462081; ENSG00000125447 [Q9NZ52-4]
ENST00000649398; ENSP00000496890; ENSG00000125447 [Q9NZ52-1]
GeneIDi23163
KEGGihsa:23163
UCSCiuc010wrw.3, human [Q9NZ52-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23163
DisGeNETi23163

GeneCards: human genes, protein and diseases

More...GeneCardsi		GGA3
HGNCiHGNC:17079, GGA3
HPAiENSG00000125447, Low tissue specificity
MIMi606006, gene
neXtProtiNX_Q9NZ52
OpenTargetsiENSG00000125447
PharmGKBiPA28659
VEuPathDBiHostDB:ENSG00000125447.16

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1087, Eukaryota
GeneTreeiENSGT00940000157333
HOGENOMiCLU_015010_0_0_1
InParanoidiQ9NZ52
OMAiDFQFEAS
OrthoDBi594067at2759
PhylomeDBiQ9NZ52
TreeFamiTF318574

Enzyme and pathway databases

PathwayCommonsiQ9NZ52
ReactomeiR-HSA-8854214, TBC/RABGAPs
R-HSA-8875656, MET receptor recycling
R-HSA-977225, Amyloid fiber formation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23163, 29 hits in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GGA3, human
EvolutionaryTraceiQ9NZ52

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GGA3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23163
PharosiQ9NZ52, Tbio

Protein Ontology

More...PROi		PR:Q9NZ52
RNActiQ9NZ52, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125447, Expressed in sural nerve and 223 other tissues
ExpressionAtlasiQ9NZ52, baseline and differential
GenevisibleiQ9NZ52, HS

Family and domain databases

CDDicd14240, GAT_GGA3, 1 hit
Gene3Di1.20.58.160, 1 hit
1.25.40.90, 1 hit
InterProiView protein in InterPro
IPR008152, Clathrin_a/b/g-adaptin_app_Ig
IPR013041, Clathrin_app_Ig-like_sf
IPR008942, ENTH_VHS
IPR008153, GAE_dom
IPR004152, GAT_dom
IPR044111, GAT_GGA3
IPR038425, GAT_sf
IPR027422, GGA3
IPR041198, GGA_N-GAT
IPR002014, VHS_dom
PANTHERiPTHR45905:SF3, PTHR45905:SF3, 1 hit
PfamiView protein in Pfam
PF02883, Alpha_adaptinC2, 1 hit
PF03127, GAT, 1 hit
PF18308, GGA_N-GAT, 1 hit
PF00790, VHS, 1 hit
SMARTiView protein in SMART
SM00809, Alpha_adaptinC2, 1 hit
SM00288, VHS, 1 hit
SUPFAMiSSF48464, SSF48464, 1 hit
SSF49348, SSF49348, 1 hit
PROSITEiView protein in PROSITE
PS50180, GAE, 1 hit
PS50909, GAT, 1 hit
PS50179, VHS, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGGA3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NZ52
Secondary accession number(s): B7Z7E2
, B7Z7M9, J3KRN0, Q15017, Q6IS16, Q9UJY3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: June 2, 2021
This is version 211 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again