Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (12 Aug 2020)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-like protein family member 12

Gene

RASL12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi27 – 34GTP8
Nucleotide bindingi74 – 78GTPBy similarity5
Nucleotide bindingi134 – 137GTP4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NYN1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-like protein family member 12 (EC:3.6.5.2By similarity)
Alternative name(s):
Ras-like protein Ris
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RASL12
Synonyms:RIS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000103710.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30289, RASL12

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NYN1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51285

Open Targets

More...
OpenTargetsi
ENSG00000103710

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134920029

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NYN1, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RASL12

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74734715

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003338681 – 266Ras-like protein family member 12Add BLAST266

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NYN1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NYN1

PeptideAtlas

More...
PeptideAtlasi
Q9NYN1

PRoteomics IDEntifications database

More...
PRIDEi
Q9NYN1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4411
5160
83255 [Q9NYN1-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NYN1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NYN1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000103710, Expressed in tibial artery and 210 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NYN1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NYN1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000103710, Tissue enhanced (seminal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119437, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NYN1, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000220062

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NYN1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1266
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NYN1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NYN1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0395, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160167

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_041217_9_4_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NYN1

KEGG Orthology (KO)

More...
KOi
K07854

Identification of Orthologs from Complete Genome Data

More...
OMAi
LSWANAF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NYN1

TreeFam database of animal gene trees

More...
TreeFami
TF318030

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR001806, Small_GTPase
IPR020849, Small_GTPase_Ras-type

The PANTHER Classification System

More...
PANTHERi
PTHR24070, PTHR24070, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00071, Ras, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00231, small_GTP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51421, RAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NYN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSVFGKPRA GSGPQSAPLE VNLAILGRRG AGKSALTVKF LTKRFISEYD
60 70 80 90 100
PNLEDTYSSE ETVDHQPVHL RVMDTADLDT PRNCERYLNW AHAFLVVYSV
110 120 130 140 150
DSRQSFDSSS SYLELLALHA KETQRSIPAL LLGNKLDMAQ YRQVTKAEGV
160 170 180 190 200
ALAGRFGCLF FEVSACLDFE HVQHVFHEAV REARRELEKS PLTRPLFISE
210 220 230 240 250
ERALPHQAPL TARHGLASCT FNTLSTINLK EMPTVAQAKL VTVKSSRAQS
260
KRKAPTLTLL KGFKIF
Length:266
Mass (Da):29,662
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCEF9841F94BE9DBA
GO
Isoform 2 (identifier: Q9NYN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKS → MVIMGPELVGSWSDFKNEAADPR

Show »
Length:255
Mass (Da):28,815
Checksum:i5691C424510786F3
GO
Isoform 3 (identifier: Q9NYN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-53: Missing.

Show »
Length:247
Mass (Da):27,424
Checksum:i35A1ADCF46BB3906
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0558451 – 34MSSVF…GAGKS → MVIMGPELVGSWSDFKNEAA DPR in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_05584635 – 53Missing in isoform 3. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF233588 mRNA Translation: AAF60286.1
AK296261 mRNA Translation: BAG58974.1
AK300536 mRNA Translation: BAG62244.1
AK314914 mRNA Translation: BAG37426.1
AC013553 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77709.1
BC053734 mRNA Translation: AAH53734.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10200.1 [Q9NYN1-1]
CCDS76769.1 [Q9NYN1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001294859.1, NM_001307930.1 [Q9NYN1-3]
NP_057647.1, NM_016563.3 [Q9NYN1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000220062; ENSP00000220062; ENSG00000103710 [Q9NYN1-1]
ENST00000421977; ENSP00000390028; ENSG00000103710 [Q9NYN1-3]
ENST00000434605; ENSP00000412787; ENSG00000103710 [Q9NYN1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51285

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51285

UCSC genome browser

More...
UCSCi
uc002aoi.2, human [Q9NYN1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233588 mRNA Translation: AAF60286.1
AK296261 mRNA Translation: BAG58974.1
AK300536 mRNA Translation: BAG62244.1
AK314914 mRNA Translation: BAG37426.1
AC013553 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77709.1
BC053734 mRNA Translation: AAH53734.1
CCDSiCCDS10200.1 [Q9NYN1-1]
CCDS76769.1 [Q9NYN1-3]
RefSeqiNP_001294859.1, NM_001307930.1 [Q9NYN1-3]
NP_057647.1, NM_016563.3 [Q9NYN1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3C5CX-ray1.85A/B/C/D18-186[»]
SMRiQ9NYN1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119437, 4 interactors
IntActiQ9NYN1, 3 interactors
STRINGi9606.ENSP00000220062

PTM databases

iPTMnetiQ9NYN1
PhosphoSitePlusiQ9NYN1

Polymorphism and mutation databases

BioMutaiRASL12
DMDMi74734715

Proteomic databases

MassIVEiQ9NYN1
PaxDbiQ9NYN1
PeptideAtlasiQ9NYN1
PRIDEiQ9NYN1
ProteomicsDBi4411
5160
83255 [Q9NYN1-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25905, 134 antibodies

The DNASU plasmid repository

More...
DNASUi
51285

Genome annotation databases

EnsembliENST00000220062; ENSP00000220062; ENSG00000103710 [Q9NYN1-1]
ENST00000421977; ENSP00000390028; ENSG00000103710 [Q9NYN1-3]
ENST00000434605; ENSP00000412787; ENSG00000103710 [Q9NYN1-2]
GeneIDi51285
KEGGihsa:51285
UCSCiuc002aoi.2, human [Q9NYN1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51285
DisGeNETi51285
EuPathDBiHostDB:ENSG00000103710.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RASL12
HGNCiHGNC:30289, RASL12
HPAiENSG00000103710, Tissue enhanced (seminal)
neXtProtiNX_Q9NYN1
OpenTargetsiENSG00000103710
PharmGKBiPA134920029

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0395, Eukaryota
GeneTreeiENSGT00940000160167
HOGENOMiCLU_041217_9_4_1
InParanoidiQ9NYN1
KOiK07854
OMAiLSWANAF
PhylomeDBiQ9NYN1
TreeFamiTF318030

Enzyme and pathway databases

PathwayCommonsiQ9NYN1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
51285, 4 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RASL12, human
EvolutionaryTraceiQ9NYN1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51285
PharosiQ9NYN1, Tbio

Protein Ontology

More...
PROi
PR:Q9NYN1
RNActiQ9NYN1, protein

Gene expression databases

BgeeiENSG00000103710, Expressed in tibial artery and 210 other tissues
ExpressionAtlasiQ9NYN1, baseline and differential
GenevisibleiQ9NYN1, HS

Family and domain databases

InterProiView protein in InterPro
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR001806, Small_GTPase
IPR020849, Small_GTPase_Ras-type
PANTHERiPTHR24070, PTHR24070, 1 hit
PfamiView protein in Pfam
PF00071, Ras, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
TIGRFAMsiTIGR00231, small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51421, RAS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRASLC_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NYN1
Secondary accession number(s): B2RC29, B4DJW2, B4DU82
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: October 1, 2000
Last modified: August 12, 2020
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again