Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Abl interactor 2

Gene

ABI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).By similarity3 Publications

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: UniProtKB
  • DNA binding Source: ProtInc
  • kinase binding Source: UniProtKB
  • proline-rich region binding Source: UniProtKB
  • protein-containing complex binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: BHF-UCL

GO - Biological processi

  • actin polymerization or depolymerization Source: UniProtKB
  • cell migration Source: UniProtKB
  • cytoskeleton organization Source: UniProtKB
  • peptidyl-tyrosine phosphorylation Source: MGI
  • positive regulation of Arp2/3 complex-mediated actin nucleation Source: UniProtKB
  • Rac protein signal transduction Source: UniProtKB
  • viral process Source: UniProtKB-KW

Keywordsi

Biological processHost-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SIGNORiQ9NYB9

Protein family/group databases

MoonDBiQ9NYB9 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
Abl interactor 2
Alternative name(s):
Abelson interactor 2
Short name:
Abi-2
Abl-binding protein 3
Short name:
AblBP3
Arg-binding protein 1
Short name:
ArgBP1
Gene namesi
Name:ABI2
Synonyms:ARGBPIA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138443.15
HGNCiHGNC:24011 ABI2
MIMi606442 gene
neXtProtiNX_Q9NYB9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi10152
OpenTargetsiENSG00000138443
PharmGKBiPA134977642

Polymorphism and mutation databases

DMDMi50400673

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001917901 – 513Abl interactor 2Add BLAST513

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei40PhosphoserineBy similarity1
Modified residuei183PhosphoserineCombined sources1
Modified residuei227PhosphoserineCombined sources1
Modified residuei361PhosphothreonineBy similarity1
Modified residuei368PhosphoserineCombined sources1

Post-translational modificationi

Is a substrate for ABL1.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NYB9
MaxQBiQ9NYB9
PeptideAtlasiQ9NYB9
PRIDEiQ9NYB9
ProteomicsDBi83209
83210 [Q9NYB9-2]
83211 [Q9NYB9-3]
83212 [Q9NYB9-4]

PTM databases

iPTMnetiQ9NYB9
PhosphoSitePlusiQ9NYB9

Expressioni

Gene expression databases

BgeeiENSG00000138443
CleanExiHS_ABI2
ExpressionAtlasiQ9NYB9 baseline and differential
GenevisibleiQ9NYB9 HS

Organism-specific databases

HPAiHPA062433
HPA070567

Interactioni

Subunit structurei

Component of the WAVE1 complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterodimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1. CYFIP2 binds to activated RAC1 which causes the complex to dissociate, releasing activated WASF1. The complex can also be activated by NCK1 (By similarity). Interacts with ABL1 and ABL2.By similarity3 Publications
(Microbial infection) Interacts with human cytomegalovirus UL135.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ABL1P005192EBI-743598,EBI-375543
ADAM19Q9H0132EBI-743598,EBI-8567699
AESQ081173EBI-743598,EBI-717810
AESQ08117-24EBI-11096309,EBI-11741437
ARHGAP32A7KAX93EBI-743598,EBI-308663
ARMC7Q9H6L43EBI-743598,EBI-742909
BLOC1S6Q9UL454EBI-11096309,EBI-465781
Caskin1Q8VHK23EBI-743598,EBI-7049475From Rattus norvegicus.
CCDC102BQ68D863EBI-743598,EBI-10171570
CCDC36Q8IYA84EBI-743598,EBI-8638439
CCHCR1Q8TD31-33EBI-743598,EBI-10175300
CENPHQ9H3R54EBI-11096309,EBI-1003700
CRXO431863EBI-743598,EBI-748171
DLGAP4Q9Y2H0-14EBI-11096309,EBI-12000556
DTNBO609413EBI-743598,EBI-740402
EFSO432813EBI-743598,EBI-718488
EGLN3Q9H6Z93EBI-743598,EBI-1175354
EIF3S3Q6IB983EBI-743598,EBI-10184995
ENKD1Q9H0I24EBI-11096309,EBI-744099
FAM109AQ8N4B1-44EBI-11096309,EBI-14131832
GCC1Q96CN93EBI-743598,EBI-746252
HGSO149643EBI-743598,EBI-740220
HNRNPKP619783EBI-743598,EBI-304185
HNRNPKP61978-24EBI-11096309,EBI-7060731
HOMER3Q9NSC55EBI-743598,EBI-748420
IFT20Q8IY314EBI-743598,EBI-744203
KIAA1217Q5T5P2-63EBI-743598,EBI-10188326
KIFC3Q9BVG83EBI-743598,EBI-2125614
KRT13A1A4E93EBI-743598,EBI-10171552
KRT15P190124EBI-743598,EBI-739566
KRT31Q153233EBI-743598,EBI-948001
KRT33BQ145253EBI-743598,EBI-1049638
LAS17Q124463EBI-11096309,EBI-10022From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
LMO1P258004EBI-11096309,EBI-8639312
LMO2P257913EBI-743598,EBI-739696
LMO2P25791-34EBI-11096309,EBI-11959475
MER1P165233EBI-11096309,EBI-10736From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
MRFAP1L1Q96HT85EBI-743598,EBI-748896
MRPL44Q9H9J23EBI-743598,EBI-713619
NCK1A0A0S2Z4D73EBI-11096309,EBI-16429340
NCK1A0A0S2Z4E43EBI-11096309,EBI-16432934
NCK2O436396EBI-11096309,EBI-713635
NHSL2Q5HYW24EBI-11096309,EBI-2859639
NUP62P371983EBI-743598,EBI-347978
PIN1Q135263EBI-743598,EBI-714158
PPIFP304053EBI-743598,EBI-5544229
PRAM1Q96QH23EBI-743598,EBI-2860740
PRDM6Q9NQX04EBI-11096309,EBI-11320284
PRKAA1Q131313EBI-743598,EBI-1181405
PRKAA2P546463EBI-743598,EBI-1383852
PRR16Q569H44EBI-11096309,EBI-5564642
SDCBPO005603EBI-743598,EBI-727004
SNU56Q037823EBI-11096309,EBI-627From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
STAM2O758863EBI-743598,EBI-373258
TFIP11Q9UBB93EBI-743598,EBI-1105213
TRIM32Q130496EBI-11096309,EBI-742790
TRIP6Q156543EBI-743598,EBI-742327
TRX3P253723EBI-11096309,EBI-19616From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
VARS2Q5ST30-43EBI-743598,EBI-10244997
VASPP505523EBI-743598,EBI-748201
WIPF1O435163EBI-743598,EBI-346356
ZNF688A0A0S2Z5X43EBI-11096309,EBI-16429014

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: UniProtKB
  • kinase binding Source: UniProtKB
  • proline-rich region binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi115454, 115 interactors
DIPiDIP-37566N
IntActiQ9NYB9, 206 interactors
MINTiQ9NYB9

Structurei

Secondary structure

1513
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1 – 9Combined sources9
Helixi11 – 39Combined sources29
Helixi43 – 110Combined sources68
Beta strandi123 – 125Combined sources3
Turni143 – 151Combined sources9
Beta strandi453 – 458Combined sources6
Beta strandi477 – 483Combined sources7
Beta strandi485 – 493Combined sources9
Beta strandi496 – 501Combined sources6
Beta strandi504 – 507Combined sources4

3D structure databases

ProteinModelPortaliQ9NYB9
SMRiQ9NYB9
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NYB9

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 107t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63
Domaini451 – 510SH3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi172 – 423Pro-richAdd BLAST252

Sequence similaritiesi

Belongs to the ABI family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

GeneTreeiENSGT00390000003756
HOGENOMiHOG000293213
HOVERGENiHBG050446
InParanoidiQ9NYB9
KOiK05751
PhylomeDBiQ9NYB9
TreeFamiTF314303

Family and domain databases

CDDicd11972 SH3_Abi2, 1 hit
InterProiView protein in InterPro
IPR028457 ABI
IPR036993 ABI2
IPR035726 Abi2_SH3
IPR012849 Abl-interactor_HHR_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000727 T_SNARE_dom
PANTHERiPTHR10460 PTHR10460, 1 hit
PTHR10460:SF0 PTHR10460:SF0, 1 hit
PfamiView protein in Pfam
PF07815 Abi_HHR, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50192 T_SNARE, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NYB9-1) [UniParc]FASTAAdd to basket
Also known as: Abi-2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELQMLLEE EIPGGRRALF DSYTNLERVA DYCENNYIQS ADKQRALEET
60 70 80 90 100
KAYTTQSLAS VAYLINTLAN NVLQMLDIQA SQLRRMESSI NHISQTVDIH
110 120 130 140 150
KEKVARREIG ILTTNKNTSR THKIIAPANL ERPVRYIRKP IDYTILDDIG
160 170 180 190 200
HGVKWLLRFK VSTQNMKMGG LPRTTPPTQK PPSPPMSGKG TLGRHSPYRT
210 220 230 240 250
LEPVRPPVVP NDYVPSPTRN MAPSQQSPVR TASVNQRNRT YSSSGSSGGS
260 270 280 290 300
HPSSRSSSRE NSGSGSVGVP IAVPTPSPPS VFPAPAGSAG TPPLPATSAS
310 320 330 340 350
APAPLVPATV PSSTAPNAAA GGAPNLADGF TSPTPPVVSS TPPTGHPVQF
360 370 380 390 400
YSMNRPASRH TPPTIGGSLP YRRPPSITSQ TSLQNQMNGG PFYSQNPVSD
410 420 430 440 450
TPPPPPPVEE PVFDESPPPP PPPEDYEEEE AAVVEYSDPY AEEDPPWAPR
460 470 480 490 500
SYLEKVVAIY DYTKDKEDEL SFQEGAIIYV IKKNDDGWYE GVMNGVTGLF
510
PGNYVESIMH YSE
Length:513
Mass (Da):55,663
Last modified:October 1, 2000 - v1
Checksum:i822983A69E5EA512
GO
Isoform 2 (identifier: Q9NYB9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.
     284-344: Missing.
     399-399: S → SLAPPPPSILQVTPQLPLMGFVARVQENIS

Show »
Length:475
Mass (Da):52,446
Checksum:i3AF8B713FD40FA90
GO
Isoform 3 (identifier: Q9NYB9-3) [UniParc]FASTAAdd to basket
Also known as: Abi-2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     46-95: ALEETKAYTT...MESSINHISQ → MSCRCWISRH...GNNCSLRLNE
     154-159: Missing.
     284-344: Missing.

Show »
Length:401
Mass (Da):44,409
Checksum:i5D009A269B2B2FFF
GO
Isoform 4 (identifier: Q9NYB9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.

Show »
Length:507
Mass (Da):54,819
Checksum:iC0CE1E991D695FC1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti22S → R in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti69A → D in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti243S → T in AAA75446 (Ref. 2) Curated1
Sequence conflicti249G → P in AAA92289 (PubMed:7590236).Curated1
Sequence conflicti317N → D in BAG61693 (PubMed:14702039).Curated1
Sequence conflicti324 – 325PN → QT in BAG61693 (PubMed:14702039).Curated2
Sequence conflicti432A → V in AAA75446 (Ref. 2) Curated1
Sequence conflicti500F → S in AAA75446 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0107591 – 45Missing in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_01076046 – 95ALEET…NHISQ → MSCRCWISRHPSYEGWNLQS IIFHKQIRGVDLESTFVTKF GNNCSLRLNE in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_010761154 – 159Missing in isoform 2, isoform 3 and isoform 4. 6 Publications6
Alternative sequenceiVSP_010762284 – 344Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST61
Alternative sequenceiVSP_010763399S → SLAPPPPSILQVTPQLPLMG FVARVQENIS in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23435 mRNA Translation: AAA92289.1
U31089 mRNA Translation: AAA75446.1
AF260261 mRNA Translation: AAF70308.1
X95632 mRNA Translation: CAA64885.1
BT009920 mRNA Translation: AAP88922.1
AK299824 mRNA Translation: BAG61693.1
BC001439 mRNA Translation: AAH01439.1
CCDSiCCDS2358.1 [Q9NYB9-2]
CCDS63093.1 [Q9NYB9-1]
CCDS63094.1 [Q9NYB9-4]
PIRiG01936
RefSeqiNP_001269854.1, NM_001282925.1
NP_001269855.1, NM_001282926.1
NP_001269856.1, NM_001282927.1 [Q9NYB9-3]
NP_005750.4, NM_005759.5 [Q9NYB9-2]
XP_006712248.1, XM_006712185.1 [Q9NYB9-3]
UniGeneiHs.471156

Genome annotation databases

EnsembliENST00000261017; ENSP00000261017; ENSG00000138443 [Q9NYB9-2]
GeneIDi10152
KEGGihsa:10152
UCSCiuc002uzz.5 human [Q9NYB9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiABI2_HUMAN
AccessioniPrimary (citable) accession number: Q9NYB9
Secondary accession number(s): B4DSN1
, Q13147, Q13249, Q13801, Q9BV70
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: October 1, 2000
Last modified: July 18, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health