Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Abl interactor 2

Gene

ABI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of actin cytoskeleton dynamics underlying cell motility and adhesion. Functions as a component of the WAVE complex, which activates actin nucleating machinery Arp2/3 to drive lamellipodia formation (PubMed:21107423). Acts as regulator and substrate of nonreceptor tyrosine kinases ABL1 and ABL2 involved in processes linked to cell growth and differentiation. Positively regulates ABL1-mediated phosphorylation of ENAH, which is required for proper polymerization of nucleated actin filaments at the leading edge (PubMed:7590236, PubMed:8649853, PubMed:10498863). Contributes to the regulation of actin assembly at the tips of neuron projections. In particular, controls dendritic spine morphogenesis and may promote dendritic spine specification toward large mushroom-type spines known as repositories of memory in the brain (By similarity). In hippocampal neurons, may mediate actin-dependent BDNF-NTRK2 early endocytic trafficking that triggers dendrite outgrowth (By similarity). Participates in ocular lens morphogenesis, likely by regulating lamellipodia-driven adherens junction formation at the epithelial cell-secondary lens fiber interface (By similarity). Also required for nascent adherens junction assembly in epithelial cells (PubMed:15572692).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cytoskeletal adaptor activity Source: UniProtKB
  • DNA binding Source: ProtInc
  • kinase binding Source: UniProtKB
  • proline-rich region binding Source: UniProtKB
  • protein-containing complex binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9NYB9

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q9NYB9 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Abl interactor 21 Publication
Alternative name(s):
Abelson interactor 21 Publication
Short name:
Abi-21 Publication
Abl-binding protein 3
Short name:
AblBP3
Arg-binding protein 11 Publication
Short name:
ArgBP11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABI21 PublicationImported
Synonyms:ARGBPIA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138443.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24011 ABI2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606442 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NYB9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10152

Open Targets

More...
OpenTargetsi
ENSG00000138443

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134977642

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400673

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001917901 – 513Abl interactor 2Add BLAST513

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei40PhosphoserineBy similarity1
Modified residuei183PhosphoserineCombined sources1
Modified residuei227PhosphoserineCombined sources1
Modified residuei361PhosphothreonineBy similarity1
Modified residuei368PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by ABL1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NYB9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NYB9

PeptideAtlas

More...
PeptideAtlasi
Q9NYB9

PRoteomics IDEntifications database

More...
PRIDEi
Q9NYB9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
83209
83210 [Q9NYB9-2]
83211 [Q9NYB9-3]
83212 [Q9NYB9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NYB9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NYB9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Abundant in testes, ovary, thymus, and colon, with lower but detectable levels in prostate, peripheral blood leukocytes, and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138443 Expressed in 226 organ(s), highest expression level in dorsolateral prefrontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_ABI2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NYB9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NYB9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062433
HPA070567

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the WAVE complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterodimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1. CYFIP2 binds to activated RAC1 which causes the complex to dissociate, releasing activated WASF1 (PubMed:21107423). Interacts (via SH3 domain) with ABL1 and ABL2 (PubMed:7590236, PubMed:8649853).3 Publications
(Microbial infection) Interacts with human cytomegalovirus UL135.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ABL1P005192EBI-743598,EBI-375543
AESQ081173EBI-743598,EBI-717810
AESQ08117-24EBI-11096309,EBI-11741437
ARHGAP32A7KAX93EBI-743598,EBI-308663
ARMC7Q9H6L43EBI-743598,EBI-742909
BLOC1S6Q9UL454EBI-11096309,EBI-465781
Caskin1Q8VHK23EBI-743598,EBI-7049475From Rattus norvegicus.
CCDC102BQ68D863EBI-743598,EBI-10171570
CCDC36Q8IYA84EBI-743598,EBI-8638439
CCHCR1Q8TD31-33EBI-743598,EBI-10175300
CENPHQ9H3R54EBI-11096309,EBI-1003700
CRXO431863EBI-743598,EBI-748171
DLGAP4Q9Y2H0-14EBI-11096309,EBI-12000556
DTNBO609413EBI-743598,EBI-740402
EFSO432813EBI-743598,EBI-718488
EGLN3Q9H6Z93EBI-743598,EBI-1175354
EIF3S3Q6IB983EBI-743598,EBI-10184995
ENKD1Q9H0I24EBI-11096309,EBI-744099
GCC1Q96CN93EBI-743598,EBI-746252
HGSO149643EBI-743598,EBI-740220
HNRNPKP619783EBI-743598,EBI-304185
HNRNPKP61978-24EBI-11096309,EBI-7060731
HOMER3Q9NSC55EBI-743598,EBI-748420
IFT20Q8IY314EBI-743598,EBI-744203
KIAA1217Q5T5P2-63EBI-743598,EBI-10188326
KIFC3Q9BVG83EBI-743598,EBI-2125614
KRT13A1A4E93EBI-743598,EBI-10171552
KRT15P190124EBI-743598,EBI-739566
KRT31Q153233EBI-743598,EBI-948001
KRT33BQ145253EBI-743598,EBI-1049638
LMO1P258004EBI-11096309,EBI-8639312
LMO2P257913EBI-743598,EBI-739696
LMO2P25791-34EBI-11096309,EBI-11959475
MRFAP1L1Q96HT85EBI-743598,EBI-748896
MRPL44Q9H9J23EBI-743598,EBI-713619
NCK1A0A0S2Z4D73EBI-11096309,EBI-16429340
NCK1A0A0S2Z4E43EBI-11096309,EBI-16432934
NCK2O436396EBI-11096309,EBI-713635
NHSL2Q5HYW24EBI-11096309,EBI-2859639
NUP62P371983EBI-743598,EBI-347978
PHETA1Q8N4B1-44EBI-11096309,EBI-14131832
PIN1Q135263EBI-743598,EBI-714158
PPIFP304053EBI-743598,EBI-5544229
PRAM1Q96QH23EBI-743598,EBI-2860740
PRDM6Q9NQX04EBI-11096309,EBI-11320284
PRKAA1Q131313EBI-743598,EBI-1181405
PRKAA2P546463EBI-743598,EBI-1383852
PRR16Q569H44EBI-11096309,EBI-5564642
SDCBPO005603EBI-743598,EBI-727004
STAM2O758863EBI-743598,EBI-373258
TFIP11Q9UBB93EBI-743598,EBI-1105213
TRIM32Q130496EBI-11096309,EBI-742790
TRIP6Q156543EBI-743598,EBI-742327
VARS2Q5ST30-43EBI-743598,EBI-10244997
VASPP505523EBI-743598,EBI-748201
WIPF1O435163EBI-743598,EBI-346356
ZNF688A0A0S2Z5X43EBI-11096309,EBI-16429014

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115454, 115 interactors

Database of interacting proteins

More...
DIPi
DIP-37566N

Protein interaction database and analysis system

More...
IntActi
Q9NYB9, 202 interactors

Molecular INTeraction database

More...
MINTi
Q9NYB9

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1513
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9NYB9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NYB9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NYB9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 107t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63
Domaini451 – 510SH3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi172 – 423Pro-richAdd BLAST252

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain is critical for binding to ABL1 and ABL2.2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ABI family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156089

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293213

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050446

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NYB9

KEGG Orthology (KO)

More...
KOi
K05751

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NYB9

TreeFam database of animal gene trees

More...
TreeFami
TF314303

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11972 SH3_Abi2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028457 ABI
IPR036993 ABI2
IPR035726 Abi2_SH3
IPR012849 Abl-interactor_HHR_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000727 T_SNARE_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10460 PTHR10460, 1 hit
PTHR10460:SF0 PTHR10460:SF0, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07815 Abi_HHR, 1 hit
PF14604 SH3_9, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit
PS50192 T_SNARE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NYB9-1) [UniParc]FASTAAdd to basket
Also known as: Abi-2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELQMLLEE EIPGGRRALF DSYTNLERVA DYCENNYIQS ADKQRALEET
60 70 80 90 100
KAYTTQSLAS VAYLINTLAN NVLQMLDIQA SQLRRMESSI NHISQTVDIH
110 120 130 140 150
KEKVARREIG ILTTNKNTSR THKIIAPANL ERPVRYIRKP IDYTILDDIG
160 170 180 190 200
HGVKWLLRFK VSTQNMKMGG LPRTTPPTQK PPSPPMSGKG TLGRHSPYRT
210 220 230 240 250
LEPVRPPVVP NDYVPSPTRN MAPSQQSPVR TASVNQRNRT YSSSGSSGGS
260 270 280 290 300
HPSSRSSSRE NSGSGSVGVP IAVPTPSPPS VFPAPAGSAG TPPLPATSAS
310 320 330 340 350
APAPLVPATV PSSTAPNAAA GGAPNLADGF TSPTPPVVSS TPPTGHPVQF
360 370 380 390 400
YSMNRPASRH TPPTIGGSLP YRRPPSITSQ TSLQNQMNGG PFYSQNPVSD
410 420 430 440 450
TPPPPPPVEE PVFDESPPPP PPPEDYEEEE AAVVEYSDPY AEEDPPWAPR
460 470 480 490 500
SYLEKVVAIY DYTKDKEDEL SFQEGAIIYV IKKNDDGWYE GVMNGVTGLF
510
PGNYVESIMH YSE
Length:513
Mass (Da):55,663
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i822983A69E5EA512
GO
Isoform 2 (identifier: Q9NYB9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.
     284-344: Missing.
     399-399: S → SLAPPPPSILQVTPQLPLMGFVARVQENIS

Show »
Length:475
Mass (Da):52,446
Checksum:i3AF8B713FD40FA90
GO
Isoform 3 (identifier: Q9NYB9-3) [UniParc]FASTAAdd to basket
Also known as: Abi-2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     46-95: ALEETKAYTT...MESSINHISQ → MSCRCWISRH...GNNCSLRLNE
     154-159: Missing.
     284-344: Missing.

Show »
Length:401
Mass (Da):44,409
Checksum:i5D009A269B2B2FFF
GO
Isoform 4 (identifier: Q9NYB9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.

Show »
Length:507
Mass (Da):54,819
Checksum:iC0CE1E991D695FC1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEZ7E9PEZ7_HUMAN
Abl interactor 2
ABI2
458Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z836B7Z836_HUMAN
cDNA FLJ51162, highly similar to Ab...
ABI2
390Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAL6F8WAL6_HUMAN
Abl interactor 2
ABI2
513Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DG21A0A0C4DG21_HUMAN
Abl interactor 2
ABI2
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6B5H0Y6B5_HUMAN
Abl interactor 2
ABI2
293Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EW77E7EW77_HUMAN
Abl interactor 2
ABI2
480Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EP65E7EP65_HUMAN
Abl interactor 2
ABI2
486Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Q7H7C3Q7_HUMAN
Abl interactor 2
ABI2
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAQ3F8WAQ3_HUMAN
Abl interactor 2
ABI2
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCD7F8WCD7_HUMAN
Abl interactor 2
ABI2
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22S → R in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti69A → D in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti243S → T in AAA75446 (Ref. 2) Curated1
Sequence conflicti249G → P in AAA92289 (PubMed:7590236).Curated1
Sequence conflicti317N → D in BAG61693 (PubMed:14702039).Curated1
Sequence conflicti324 – 325PN → QT in BAG61693 (PubMed:14702039).Curated2
Sequence conflicti432A → V in AAA75446 (Ref. 2) Curated1
Sequence conflicti500F → S in AAA75446 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080776132 – 513Missing Probable disease-associated mutation found in a consanguineous family with intellectual disability. 1 PublicationAdd BLAST382

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0107591 – 45Missing in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_01076046 – 95ALEET…NHISQ → MSCRCWISRHPSYEGWNLQS IIFHKQIRGVDLESTFVTKF GNNCSLRLNE in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_010761154 – 159Missing in isoform 2, isoform 3 and isoform 4. 6 Publications6
Alternative sequenceiVSP_010762284 – 344Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST61
Alternative sequenceiVSP_010763399S → SLAPPPPSILQVTPQLPLMG FVARVQENIS in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U23435 mRNA Translation: AAA92289.1
U31089 mRNA Translation: AAA75446.1
AF260261 mRNA Translation: AAF70308.1
X95632 mRNA Translation: CAA64885.1
BT009920 mRNA Translation: AAP88922.1
AK299824 mRNA Translation: BAG61693.1
BC001439 mRNA Translation: AAH01439.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2358.1 [Q9NYB9-2]
CCDS63093.1 [Q9NYB9-1]
CCDS63094.1 [Q9NYB9-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
G01936

NCBI Reference Sequences

More...
RefSeqi
NP_001269854.1, NM_001282925.1
NP_001269855.1, NM_001282926.1
NP_001269856.1, NM_001282927.1 [Q9NYB9-3]
NP_005750.4, NM_005759.5 [Q9NYB9-2]
XP_006712248.1, XM_006712185.1 [Q9NYB9-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.471156

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261017; ENSP00000261017; ENSG00000138443 [Q9NYB9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10152

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10152

UCSC genome browser

More...
UCSCi
uc002uzz.5 human [Q9NYB9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23435 mRNA Translation: AAA92289.1
U31089 mRNA Translation: AAA75446.1
AF260261 mRNA Translation: AAF70308.1
X95632 mRNA Translation: CAA64885.1
BT009920 mRNA Translation: AAP88922.1
AK299824 mRNA Translation: BAG61693.1
BC001439 mRNA Translation: AAH01439.1
CCDSiCCDS2358.1 [Q9NYB9-2]
CCDS63093.1 [Q9NYB9-1]
CCDS63094.1 [Q9NYB9-4]
PIRiG01936
RefSeqiNP_001269854.1, NM_001282925.1
NP_001269855.1, NM_001282926.1
NP_001269856.1, NM_001282927.1 [Q9NYB9-3]
NP_005750.4, NM_005759.5 [Q9NYB9-2]
XP_006712248.1, XM_006712185.1 [Q9NYB9-3]
UniGeneiHs.471156

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ED0NMR-A444-508[»]
3P8CX-ray2.29F1-154[»]
4N78X-ray2.43F1-513[»]
ProteinModelPortaliQ9NYB9
SMRiQ9NYB9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115454, 115 interactors
DIPiDIP-37566N
IntActiQ9NYB9, 202 interactors
MINTiQ9NYB9

Protein family/group databases

MoonDBiQ9NYB9 Predicted

PTM databases

iPTMnetiQ9NYB9
PhosphoSitePlusiQ9NYB9

Polymorphism and mutation databases

DMDMi50400673

Proteomic databases

EPDiQ9NYB9
MaxQBiQ9NYB9
PeptideAtlasiQ9NYB9
PRIDEiQ9NYB9
ProteomicsDBi83209
83210 [Q9NYB9-2]
83211 [Q9NYB9-3]
83212 [Q9NYB9-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10152
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261017; ENSP00000261017; ENSG00000138443 [Q9NYB9-2]
GeneIDi10152
KEGGihsa:10152
UCSCiuc002uzz.5 human [Q9NYB9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10152
DisGeNETi10152
EuPathDBiHostDB:ENSG00000138443.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABI2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0002759
HGNCiHGNC:24011 ABI2
HPAiHPA062433
HPA070567
MIMi606442 gene
neXtProtiNX_Q9NYB9
OpenTargetsiENSG00000138443
PharmGKBiPA134977642

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000156089
HOGENOMiHOG000293213
HOVERGENiHBG050446
InParanoidiQ9NYB9
KOiK05751
PhylomeDBiQ9NYB9
TreeFamiTF314303

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SIGNORiQ9NYB9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABI2 human
EvolutionaryTraceiQ9NYB9

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ABI2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10152

Protein Ontology

More...
PROi
PR:Q9NYB9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138443 Expressed in 226 organ(s), highest expression level in dorsolateral prefrontal cortex
CleanExiHS_ABI2
ExpressionAtlasiQ9NYB9 baseline and differential
GenevisibleiQ9NYB9 HS

Family and domain databases

CDDicd11972 SH3_Abi2, 1 hit
InterProiView protein in InterPro
IPR028457 ABI
IPR036993 ABI2
IPR035726 Abi2_SH3
IPR012849 Abl-interactor_HHR_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000727 T_SNARE_dom
PANTHERiPTHR10460 PTHR10460, 1 hit
PTHR10460:SF0 PTHR10460:SF0, 1 hit
PfamiView protein in Pfam
PF07815 Abi_HHR, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50192 T_SNARE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABI2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NYB9
Secondary accession number(s): B4DSN1
, Q13147, Q13249, Q13801, Q9BV70
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: October 1, 2000
Last modified: December 5, 2018
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again