Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (17 Jun 2020)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Abl interactor 2

Gene

ABI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of actin cytoskeleton dynamics underlying cell motility and adhesion. Functions as a component of the WAVE complex, which activates actin nucleating machinery Arp2/3 to drive lamellipodia formation (PubMed:21107423). Acts as regulator and substrate of nonreceptor tyrosine kinases ABL1 and ABL2 involved in processes linked to cell growth and differentiation. Positively regulates ABL1-mediated phosphorylation of ENAH, which is required for proper polymerization of nucleated actin filaments at the leading edge (PubMed:7590236, PubMed:8649853, PubMed:10498863). Contributes to the regulation of actin assembly at the tips of neuron projections. In particular, controls dendritic spine morphogenesis and may promote dendritic spine specification toward large mushroom-type spines known as repositories of memory in the brain (By similarity). In hippocampal neurons, may mediate actin-dependent BDNF-NTRK2 early endocytic trafficking that triggers dendrite outgrowth (By similarity). Participates in ocular lens morphogenesis, likely by regulating lamellipodia-driven adherens junction formation at the epithelial cell-secondary lens fiber interface (By similarity). Also required for nascent adherens junction assembly in epithelial cells (PubMed:15572692).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9NYB9

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q9NYB9 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Abl interactor 21 Publication
Alternative name(s):
Abelson interactor 21 Publication
Short name:
Abi-21 Publication
Abl-binding protein 3
Short name:
AblBP3
Arg-binding protein 11 Publication
Short name:
ArgBP11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABI21 PublicationImported
Synonyms:ARGBPIA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138443.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24011 ABI2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606442 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NYB9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10152

Open Targets

More...
OpenTargetsi
ENSG00000138443

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134977642

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NYB9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ABI2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400673

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001917901 – 513Abl interactor 2Add BLAST513

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei40PhosphoserineBy similarity1
Modified residuei183PhosphoserineCombined sources1
Modified residuei227PhosphoserineCombined sources1
Modified residuei361PhosphothreonineBy similarity1
Modified residuei368PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by ABL1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NYB9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NYB9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NYB9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NYB9

PeptideAtlas

More...
PeptideAtlasi
Q9NYB9

PRoteomics IDEntifications database

More...
PRIDEi
Q9NYB9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83209 [Q9NYB9-1]
83210 [Q9NYB9-2]
83211 [Q9NYB9-3]
83212 [Q9NYB9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NYB9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NYB9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Abundant in testes, ovary, thymus, and colon, with lower but detectable levels in prostate, peripheral blood leukocytes, and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138443 Expressed in dorsolateral prefrontal cortex and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NYB9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NYB9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000138443 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the WAVE complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterodimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1. CYFIP2 binds to activated RAC1 which causes the complex to dissociate, releasing activated WASF1 (PubMed:21107423).

Interacts (via SH3 domain) with ABL1 and ABL2 (PubMed:7590236, PubMed:8649853).

3 Publications

(Microbial infection) Interacts with human cytomegalovirus UL135.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q9NYB9
With#Exp.IntAct
itself3EBI-743598,EBI-743598
ABL1 [P00519]2EBI-743598,EBI-375543
ARHGAP32 [A7KAX9]4EBI-743598,EBI-308663
ARMC7 [Q9H6L4]4EBI-743598,EBI-742909
BLOC1S6 [Q9UL45]5EBI-743598,EBI-465781
CCDC102B [Q68D86]5EBI-743598,EBI-10171570
CCDC36 [Q8IYA8]6EBI-743598,EBI-8638439
CCHCR1 [Q8TD31]3EBI-743598,EBI-949834
CCHCR1 - isoform 3 [Q8TD31-3]3EBI-743598,EBI-10175300
CRX [O43186]5EBI-743598,EBI-748171
DTNB [O60941]6EBI-743598,EBI-740402
EFS [O43281]6EBI-743598,EBI-718488
EGLN3 [Q9H6Z9]3EBI-743598,EBI-1175354
EIF3S3 [Q6IB98]3EBI-743598,EBI-10184995
GCC1 [Q96CN9]4EBI-743598,EBI-746252
HGS [O14964]5EBI-743598,EBI-740220
HNRNPK [P61978]6EBI-743598,EBI-304185
HOMER3 [Q9NSC5]7EBI-743598,EBI-748420
IFT20 [Q8IY31]6EBI-743598,EBI-744203
KIAA1217 - isoform 6 [Q5T5P2-6]3EBI-743598,EBI-10188326
KIFC3 [Q9BVG8]5EBI-743598,EBI-2125614
KRT13 [A1A4E9]3EBI-743598,EBI-10171552
KRT15 [P19012]6EBI-743598,EBI-739566
KRT19 [P08727]3EBI-743598,EBI-742756
KRT20 [P35900]3EBI-743598,EBI-742094
KRT31 [Q15323]5EBI-743598,EBI-948001
KRT33B [Q14525]3EBI-743598,EBI-1049638
LMO2 [P25791]5EBI-743598,EBI-739696
MRFAP1L1 [Q96HT8]7EBI-743598,EBI-748896
MRPL44 [Q9H9J2]3EBI-743598,EBI-713619
NCK2 [O43639]6EBI-743598,EBI-713635
NUP62 [P37198]6EBI-743598,EBI-347978
PCM1 [Q15154]3EBI-743598,EBI-741421
PIN1 [Q13526]5EBI-743598,EBI-714158
PPIF [P30405]4EBI-743598,EBI-5544229
PRAM1 [Q96QH2]3EBI-743598,EBI-2860740
PRKAA1 [Q13131]5EBI-743598,EBI-1181405
PRKAA2 [P54646]5EBI-743598,EBI-1383852
PRR16 [Q569H4]4EBI-743598,EBI-5564642
SDCBP [O00560]5EBI-743598,EBI-727004
STAM2 [O75886]5EBI-743598,EBI-373258
TFIP11 [Q9UBB9]6EBI-743598,EBI-1105213
TLE5 [Q08117]5EBI-743598,EBI-717810
TRIM32 [Q13049]6EBI-743598,EBI-742790
TRIP6 [Q15654]5EBI-743598,EBI-742327
VARS2 - isoform 4 [Q5ST30-4]3EBI-743598,EBI-10244997
VASP [P50552]5EBI-743598,EBI-748201
VCL [P18206]3EBI-743598,EBI-716775
WASHC3 [Q9Y3C0]4EBI-743598,EBI-712969
WIPF1 [O43516]4EBI-743598,EBI-346356
Caskin1 [Q8VHK2] from Rattus norvegicus.3EBI-743598,EBI-7049475
ABI2 - isoform 2 [Q9NYB9-2]
With#Exp.IntAct
ABI1 - isoform 5 [Q8IZP0-5]3EBI-11096309,EBI-11743294
itself3EBI-11096309,EBI-11096309
ABI3 [Q9P2A4]5EBI-11096309,EBI-742038
ABL2 - isoform 3 [P42684-3]3EBI-11096309,EBI-10693977
ABLIM3 - isoform 2 [O94929-2]3EBI-11096309,EBI-11961672
AKAP8L [Q9ULX6]3EBI-11096309,EBI-357530
AKAP9 [Q6PJH3]3EBI-11096309,EBI-11745576
ANKRD55 [Q3KP44]3EBI-11096309,EBI-14493093
ANKS1A [Q49AR9]3EBI-11096309,EBI-11954519
ATP23 [Q9Y6H3]3EBI-11096309,EBI-12811889
BAG4 [O95429]5EBI-11096309,EBI-2949658
BIN3 [Q9NQY0]7EBI-11096309,EBI-2653038
BLOC1S5 [Q8TDH9]3EBI-11096309,EBI-465861
BLOC1S6 [Q9UL45]6EBI-11096309,EBI-465781
BORCS6 [Q96GS4]5EBI-11096309,EBI-10193358
C19orf54 - isoform 3 [Q5BKX5-3]5EBI-11096309,EBI-11976299
C1orf109 [Q9NX04]3EBI-11096309,EBI-8643161
C1orf216 [Q8TAB5]3EBI-11096309,EBI-747505
C20orf202 [A1L168]3EBI-11096309,EBI-18396958
C4orf17 [Q53FE4]3EBI-11096309,EBI-715110
CASC1 [Q6TDU7]3EBI-11096309,EBI-5235378
CCDC102B [Q68D86]3EBI-11096309,EBI-10171570
CCDC115 [Q96NT0]5EBI-11096309,EBI-2810325
CCDC36 [Q8IYA8]3EBI-11096309,EBI-8638439
CCDC57 - isoform 2 [Q2TAC2-2]3EBI-11096309,EBI-10961624
CCDC74B - isoform 2 [Q96LY2-2]3EBI-11096309,EBI-17967022
CCHCR1 - isoform 3 [Q8TD31-3]3EBI-11096309,EBI-10175300
CENPH [Q9H3R5]6EBI-11096309,EBI-1003700
CENPQ [Q7L2Z9]3EBI-11096309,EBI-2350265
CEP44 [Q9C0F1]3EBI-11096309,EBI-744115
CEP57 - isoform 3 [Q86XR8-3]3EBI-11096309,EBI-11752486
CLPP [Q16740]3EBI-11096309,EBI-1056029
COG3 - isoform 2 [Q96JB2-2]3EBI-11096309,EBI-9091495
CUEDC1 [Q9NWM3]3EBI-11096309,EBI-5838167
DCTN2 [Q13561]3EBI-11096309,EBI-715074
DISC1 - isoform 2 [Q9NRI5-2]3EBI-11096309,EBI-11988027
DLGAP2 - isoform 3 [Q9P1A6-3]3EBI-11096309,EBI-12019838
DLGAP4 - isoform 2 [Q9Y2H0-1]3EBI-11096309,EBI-12000556
DTNB - isoform 5 [O60941-5]5EBI-11096309,EBI-11984733
EFS - isoform Efs2 [O43281-2]5EBI-11096309,EBI-11525448
EGR4 [Q05215]3EBI-11096309,EBI-19949420
ENKD1 [Q9H0I2]6EBI-11096309,EBI-744099
EPS8L1 - isoform 2 [Q8TE68-2]3EBI-11096309,EBI-12003490
FAM161B [Q96MY7]3EBI-11096309,EBI-7225287
FAM166B - isoform 2 [A8MTA8-2]3EBI-11096309,EBI-12160437
FAM214B [Q7L5A3]3EBI-11096309,EBI-745689
FAM90A1 [Q86YD7]3EBI-11096309,EBI-6658203
FAM9C [Q8IZT9]3EBI-11096309,EBI-2870039
FBXL19 - isoform 2 [Q6PCT2-2]3EBI-11096309,EBI-11959077
FHL5 [Q5TD97]3EBI-11096309,EBI-750641
FKBP1A [Q0VDC6]3EBI-11096309,EBI-10226858
FOXD4L1 [Q9NU39]3EBI-11096309,EBI-11320806
GAS2L2 [Q8NHY3]3EBI-11096309,EBI-7960826
GFAP [P14136]3EBI-11096309,EBI-744302
GGN [Q86UU5]3EBI-11096309,EBI-10259069
GPANK1 [O95872]3EBI-11096309,EBI-751540
hCG_1987119 [A0A024R8L2]3EBI-11096309,EBI-14103818
HHEX [Q03014]3EBI-11096309,EBI-747421
HNRNPK - isoform 2 [P61978-2]6EBI-11096309,EBI-7060731
HOMER3 [Q9NSC5]3EBI-11096309,EBI-748420
HSF2BP [O75031]3EBI-11096309,EBI-7116203
IFT20 - isoform 3 [Q8IY31-3]7EBI-11096309,EBI-9091197
INCA1 [Q0VD86]3EBI-11096309,EBI-6509505
INO80B [Q9C086]3EBI-11096309,EBI-715611
INSYN1 [Q2T9L4]3EBI-11096309,EBI-4311436
KIAA1217 - isoform 6 [Q5T5P2-6]3EBI-11096309,EBI-10188326
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-11096309,EBI-14069005
KNSTRN [Q9Y448]3EBI-11096309,EBI-373334
KRT14 [P02533]3EBI-11096309,EBI-702178
KRT15 [P19012]3EBI-11096309,EBI-739566
KRT19 [P08727]3EBI-11096309,EBI-742756
KRT24 [Q2M2I5]3EBI-11096309,EBI-2952736
KRT27 [Q7Z3Y8]3EBI-11096309,EBI-3044087
KRT34 [O76011]3EBI-11096309,EBI-1047093
KRT36 - isoform 2 [O76013-2]3EBI-11096309,EBI-11958506
KRT75 [O95678]3EBI-11096309,EBI-2949715
LENG1 [Q96BZ8]3EBI-11096309,EBI-726510
LGALS9B [Q3B8N2]3EBI-11096309,EBI-10240775
LHX3 - isoform B [Q9UBR4-2]3EBI-11096309,EBI-12039345
LHX8 [Q68G74]3EBI-11096309,EBI-8474075
LMO1 [P25800]8EBI-11096309,EBI-8639312
LMO2 - isoform 3 [P25791-3]6EBI-11096309,EBI-11959475
LMO3 - isoform 4 [Q8TAP4-4]3EBI-11096309,EBI-11742507
LMO4 [P61968]3EBI-11096309,EBI-2798728
LNX1 [Q8TBB1]3EBI-11096309,EBI-739832
LURAP1 [Q96LR2]3EBI-11096309,EBI-741355
LZTS2 [Q9BRK4]3EBI-11096309,EBI-741037
MAGEA1 [P43355]3EBI-11096309,EBI-740978
MED10 [Q9BTT4]3EBI-11096309,EBI-394354
MED11 [Q9P086]3EBI-11096309,EBI-394704
MED29 [Q9NX70]3EBI-11096309,EBI-394656
MEOX2 [Q6FHY5]3EBI-11096309,EBI-16439278
MRFAP1 [Q9Y605]5EBI-11096309,EBI-995714
MRPL28 [Q13084]3EBI-11096309,EBI-723426
MYOG [P15173]3EBI-11096309,EBI-3906629
MYOZ3 [Q8TDC0]3EBI-11096309,EBI-5662487
NCK1 [A0A0S2Z4D7]3EBI-11096309,EBI-16429340
NCK1 [A0A0S2Z4E4]3EBI-11096309,EBI-16432934
NCK2 [O43639]10EBI-11096309,EBI-713635
NCKIPSD - isoform 3 [Q9NZQ3-3]3EBI-11096309,EBI-10963850
NFASC - isoform 3 [O94856-3]3EBI-11096309,EBI-12035911
NHSL2 [Q5HYW2]9EBI-11096309,EBI-2859639
NME4 [O00746]3EBI-11096309,EBI-744871
OIP5 [O43482]3EBI-11096309,EBI-536879
OOEP [A6NGQ2]3EBI-11096309,EBI-18583589
PAK2 [Q13177]3EBI-11096309,EBI-1045887
PCM1 - isoform 3 [Q15154-3]3EBI-11096309,EBI-11742977
PDLIM7 [Q9NR12]3EBI-11096309,EBI-350517
PFDN5 [Q99471]3EBI-11096309,EBI-357275
PHETA1 - isoform 4 [Q8N4B1-4]8EBI-11096309,EBI-14131832
PHF1 [O43189]3EBI-11096309,EBI-530034
PIN1 [Q13526]3EBI-11096309,EBI-714158
PLEKHN1 - isoform 3 [Q494U1-3]3EBI-11096309,EBI-12014286
POMC [P01189]3EBI-11096309,EBI-12219503
PPIF [P30405]3EBI-11096309,EBI-5544229
PPP3CA - isoform 2 [Q08209-2]3EBI-11096309,EBI-11959013
PRDM14 [Q9GZV8]3EBI-11096309,EBI-3957793
PRDM6 [Q9NQX0]3EBI-11096309,EBI-11320284
PRKAA2 [P54646]3EBI-11096309,EBI-1383852
PRR16 [Q569H4]8EBI-11096309,EBI-5564642
PRR20D [P86480]3EBI-11096309,EBI-12754095
PSMA1 [P25786]3EBI-11096309,EBI-359352
PWWP2B [Q6NUJ5]3EBI-11096309,EBI-10251192
RABEP1 [Q15276]3EBI-11096309,EBI-447043
RABGEF1 - isoform 3 [Q9UJ41-4]3EBI-11096309,EBI-14093916
RASD1 [Q9Y272]3EBI-11096309,EBI-740818
RNPS1 [Q15287]3EBI-11096309,EBI-395959
RPP25 [Q9BUL9]3EBI-11096309,EBI-366570
RSPH14 [Q9UHP6]3EBI-11096309,EBI-748350
RUSC1 [Q9BVN2]3EBI-11096309,EBI-6257312
SCGN [O76038]3EBI-11096309,EBI-749420
SH3BP1 [Q9Y3L3]3EBI-11096309,EBI-346869
SLA - isoform 3 [Q13239-3]3EBI-11096309,EBI-17630587
SMARCD1 [Q96GM5]3EBI-11096309,EBI-358489
SNAP91 - isoform 3 [O60641-3]3EBI-11096309,EBI-12854506
SNAPIN [O95295]5EBI-11096309,EBI-296723
SNX18 [Q96RF0]3EBI-11096309,EBI-298169
SNX7 - isoform 3 [Q9UNH6-3]3EBI-11096309,EBI-12424584
SORBS3 [O60504]3EBI-11096309,EBI-741237
STAM2 [O75886]3EBI-11096309,EBI-373258
STX19 [Q8N4C7]3EBI-11096309,EBI-8484990
STX4 [Q12846]3EBI-11096309,EBI-744942
TLE5 - isoform 2 [Q08117-2]6EBI-11096309,EBI-11741437
TPM2 - isoform 2 [P07951-2]3EBI-11096309,EBI-10977815
TRIM32 [Q13049]8EBI-11096309,EBI-742790
TRIM72 [Q6ZMU5]3EBI-11096309,EBI-2341648
TRIML2 [Q8N7C3]3EBI-11096309,EBI-11059915
UBQLN2 [Q9UHD9]3EBI-11096309,EBI-947187
USHBP1 [Q8N6Y0]3EBI-11096309,EBI-739895
USP2 [O75604]3EBI-11096309,EBI-743272
VARS2 [Q5ST30]3EBI-11096309,EBI-2116622
VPS28 - isoform 2 [Q9UK41-2]3EBI-11096309,EBI-12146727
WASF3 - isoform 2 [Q9UPY6-2]3EBI-11096309,EBI-12026286
WASHC3 [Q9Y3C0]5EBI-11096309,EBI-712969
WASL [O00401]5EBI-11096309,EBI-957615
WIPF1 - isoform 4 [O43516-4]3EBI-11096309,EBI-12052927
WWOX - isoform 5 [Q9NZC7-5]5EBI-11096309,EBI-12040603
ZFP90 [Q8TF47]3EBI-11096309,EBI-11419867
ZMYND12 [Q9H0C1]5EBI-11096309,EBI-12030590
ZNF474 [Q6S9Z5]3EBI-11096309,EBI-17269964
ZNF688 [A0A0S2Z5X4]3EBI-11096309,EBI-16429014
ZNF688 [P0C7X2]3EBI-11096309,EBI-4395732

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115454, 125 interactors

Database of interacting proteins

More...
DIPi
DIP-37566N

Protein interaction database and analysis system

More...
IntActi
Q9NYB9, 236 interactors

Molecular INTeraction database

More...
MINTi
Q9NYB9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000295851

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NYB9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1513
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NYB9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NYB9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 107t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63
Domaini451 – 510SH3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi172 – 423Pro-richAdd BLAST252

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 domain is critical for binding to ABL1 and ABL2.2 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ABI family.Curated

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156089

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NYB9

KEGG Orthology (KO)

More...
KOi
K05751

Database of Orthologous Groups

More...
OrthoDBi
1478981at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NYB9

TreeFam database of animal gene trees

More...
TreeFami
TF314303

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11972 SH3_Abi2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028457 ABI
IPR036993 ABI2
IPR035726 Abi2_SH3
IPR012849 Abl-interactor_HHR_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000727 T_SNARE_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10460 PTHR10460, 2 hits
PTHR10460:SF26 PTHR10460:SF26, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07815 Abi_HHR, 1 hit
PF14604 SH3_9, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit
PS50192 T_SNARE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NYB9-1) [UniParc]FASTAAdd to basket
Also known as: Abi-2b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELQMLLEE EIPGGRRALF DSYTNLERVA DYCENNYIQS ADKQRALEET
60 70 80 90 100
KAYTTQSLAS VAYLINTLAN NVLQMLDIQA SQLRRMESSI NHISQTVDIH
110 120 130 140 150
KEKVARREIG ILTTNKNTSR THKIIAPANL ERPVRYIRKP IDYTILDDIG
160 170 180 190 200
HGVKWLLRFK VSTQNMKMGG LPRTTPPTQK PPSPPMSGKG TLGRHSPYRT
210 220 230 240 250
LEPVRPPVVP NDYVPSPTRN MAPSQQSPVR TASVNQRNRT YSSSGSSGGS
260 270 280 290 300
HPSSRSSSRE NSGSGSVGVP IAVPTPSPPS VFPAPAGSAG TPPLPATSAS
310 320 330 340 350
APAPLVPATV PSSTAPNAAA GGAPNLADGF TSPTPPVVSS TPPTGHPVQF
360 370 380 390 400
YSMNRPASRH TPPTIGGSLP YRRPPSITSQ TSLQNQMNGG PFYSQNPVSD
410 420 430 440 450
TPPPPPPVEE PVFDESPPPP PPPEDYEEEE AAVVEYSDPY AEEDPPWAPR
460 470 480 490 500
SYLEKVVAIY DYTKDKEDEL SFQEGAIIYV IKKNDDGWYE GVMNGVTGLF
510
PGNYVESIMH YSE
Length:513
Mass (Da):55,663
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i822983A69E5EA512
GO
Isoform 2 (identifier: Q9NYB9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.
     284-344: Missing.
     399-399: S → SLAPPPPSILQVTPQLPLMGFVARVQENIS

Show »
Length:475
Mass (Da):52,446
Checksum:i3AF8B713FD40FA90
GO
Isoform 3 (identifier: Q9NYB9-3) [UniParc]FASTAAdd to basket
Also known as: Abi-2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     46-95: ALEETKAYTT...MESSINHISQ → MSCRCWISRH...GNNCSLRLNE
     154-159: Missing.
     284-344: Missing.

Show »
Length:401
Mass (Da):44,409
Checksum:i5D009A269B2B2FFF
GO
Isoform 4 (identifier: Q9NYB9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-159: Missing.

Show »
Length:507
Mass (Da):54,819
Checksum:iC0CE1E991D695FC1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEZ7E9PEZ7_HUMAN
Abl interactor 2
ABI2
458Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAL6F8WAL6_HUMAN
Abl interactor 2
ABI2
513Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DG21A0A0C4DG21_HUMAN
Abl interactor 2
ABI2
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z836B7Z836_HUMAN
Abl interactor 2
ABI2
390Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6B5H0Y6B5_HUMAN
Abl interactor 2
ABI2
293Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EW77E7EW77_HUMAN
Abl interactor 2
ABI2
480Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EP65E7EP65_HUMAN
Abl interactor 2
ABI2
486Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Q7H7C3Q7_HUMAN
Abl interactor 2
ABI2
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCD7F8WCD7_HUMAN
Abl interactor 2
ABI2
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAZ8F8WAZ8_HUMAN
Abl interactor 2
ABI2
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22S → R in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti69A → D in CAA64885 (PubMed:8649853).Curated1
Sequence conflicti243S → T in AAA75446 (Ref. 2) Curated1
Sequence conflicti249G → P in AAA92289 (PubMed:7590236).Curated1
Sequence conflicti317N → D in BAG61693 (PubMed:14702039).Curated1
Sequence conflicti324 – 325PN → QT in BAG61693 (PubMed:14702039).Curated2
Sequence conflicti432A → V in AAA75446 (Ref. 2) Curated1
Sequence conflicti500F → S in AAA75446 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080776132 – 513Missing Probable disease-associated variant found in a consanguineous family with intellectual disability. 1 PublicationAdd BLAST382

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0107591 – 45Missing in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_01076046 – 95ALEET…NHISQ → MSCRCWISRHPSYEGWNLQS IIFHKQIRGVDLESTFVTKF GNNCSLRLNE in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_010761154 – 159Missing in isoform 2, isoform 3 and isoform 4. 6 Publications6
Alternative sequenceiVSP_010762284 – 344Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST61
Alternative sequenceiVSP_010763399S → SLAPPPPSILQVTPQLPLMG FVARVQENIS in isoform 2. 4 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U23435 mRNA Translation: AAA92289.1
U31089 mRNA Translation: AAA75446.1
AF260261 mRNA Translation: AAF70308.1
X95632 mRNA Translation: CAA64885.1
BT009920 mRNA Translation: AAP88922.1
AK299824 mRNA Translation: BAG61693.1
BC001439 mRNA Translation: AAH01439.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2358.1 [Q9NYB9-2]
CCDS63093.1 [Q9NYB9-1]
CCDS63094.1 [Q9NYB9-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
G01936

NCBI Reference Sequences

More...
RefSeqi
NP_001269854.1, NM_001282925.1
NP_001269855.1, NM_001282926.1
NP_001269856.1, NM_001282927.1 [Q9NYB9-3]
NP_005750.4, NM_005759.5 [Q9NYB9-2]
XP_006712248.1, XM_006712185.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261017; ENSP00000261017; ENSG00000138443 [Q9NYB9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10152

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10152

UCSC genome browser

More...
UCSCi
uc002uzz.5 human [Q9NYB9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U23435 mRNA Translation: AAA92289.1
U31089 mRNA Translation: AAA75446.1
AF260261 mRNA Translation: AAF70308.1
X95632 mRNA Translation: CAA64885.1
BT009920 mRNA Translation: AAP88922.1
AK299824 mRNA Translation: BAG61693.1
BC001439 mRNA Translation: AAH01439.1
CCDSiCCDS2358.1 [Q9NYB9-2]
CCDS63093.1 [Q9NYB9-1]
CCDS63094.1 [Q9NYB9-4]
PIRiG01936
RefSeqiNP_001269854.1, NM_001282925.1
NP_001269855.1, NM_001282926.1
NP_001269856.1, NM_001282927.1 [Q9NYB9-3]
NP_005750.4, NM_005759.5 [Q9NYB9-2]
XP_006712248.1, XM_006712185.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ED0NMR-A444-508[»]
3P8CX-ray2.29F1-154[»]
4N78X-ray2.43F1-513[»]
SMRiQ9NYB9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115454, 125 interactors
DIPiDIP-37566N
IntActiQ9NYB9, 236 interactors
MINTiQ9NYB9
STRINGi9606.ENSP00000295851

Protein family/group databases

MoonDBiQ9NYB9 Predicted

PTM databases

iPTMnetiQ9NYB9
PhosphoSitePlusiQ9NYB9

Polymorphism and mutation databases

BioMutaiABI2
DMDMi50400673

Proteomic databases

EPDiQ9NYB9
jPOSTiQ9NYB9
MassIVEiQ9NYB9
MaxQBiQ9NYB9
PeptideAtlasiQ9NYB9
PRIDEiQ9NYB9
ProteomicsDBi83209 [Q9NYB9-1]
83210 [Q9NYB9-2]
83211 [Q9NYB9-3]
83212 [Q9NYB9-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34165 211 antibodies

The DNASU plasmid repository

More...
DNASUi
10152

Genome annotation databases

EnsembliENST00000261017; ENSP00000261017; ENSG00000138443 [Q9NYB9-2]
GeneIDi10152
KEGGihsa:10152
UCSCiuc002uzz.5 human [Q9NYB9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10152
DisGeNETi10152
EuPathDBiHostDB:ENSG00000138443.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABI2
HGNCiHGNC:24011 ABI2
HPAiENSG00000138443 Low tissue specificity
MIMi606442 gene
neXtProtiNX_Q9NYB9
OpenTargetsiENSG00000138443
PharmGKBiPA134977642

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000156089
InParanoidiQ9NYB9
KOiK05751
OrthoDBi1478981at2759
PhylomeDBiQ9NYB9
TreeFamiTF314303

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SIGNORiQ9NYB9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
10152 2 hits in 787 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABI2 human
EvolutionaryTraceiQ9NYB9

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ABI2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10152
PharosiQ9NYB9 Tbio

Protein Ontology

More...
PROi
PR:Q9NYB9
RNActiQ9NYB9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138443 Expressed in dorsolateral prefrontal cortex and 225 other tissues
ExpressionAtlasiQ9NYB9 baseline and differential
GenevisibleiQ9NYB9 HS

Family and domain databases

CDDicd11972 SH3_Abi2, 1 hit
InterProiView protein in InterPro
IPR028457 ABI
IPR036993 ABI2
IPR035726 Abi2_SH3
IPR012849 Abl-interactor_HHR_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR000727 T_SNARE_dom
PANTHERiPTHR10460 PTHR10460, 2 hits
PTHR10460:SF26 PTHR10460:SF26, 2 hits
PfamiView protein in Pfam
PF07815 Abi_HHR, 1 hit
PF14604 SH3_9, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50192 T_SNARE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABI2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NYB9
Secondary accession number(s): B4DSN1
, Q13147, Q13249, Q13801, Q9BV70
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: October 1, 2000
Last modified: June 17, 2020
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again