Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (02 Jun 2021)
Sequence version 3 (12 Aug 2020)
Previous versions | rss
Add a publicationFeedback
Protein

Vascular non-inflammatory molecule 3

Gene

VNN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei80Proton acceptorPROSITE-ProRule annotation1
Active sitei179Proton donorPROSITE-ProRule annotation1
Active sitei212NucleophilePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.5.1.92, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NY84

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-163125, Post-translational modification: synthesis of GPI-anchored proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vascular non-inflammatory molecule 3 (EC:3.5.1.92)
Short name:
Vanin-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VNN3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16431, VNN3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606592, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NY84

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000093134.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55350

Open Targets

More...
OpenTargetsi
ENSG00000093134

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NY84, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VNN3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
88952267

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001972023 – 274Vascular non-inflammatory molecule 3Add BLAST252

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi39N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi147N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NY84

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NY84

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NY84

PeptideAtlas

More...
PeptideAtlasi
Q9NY84

PRoteomics IDEntifications database

More...
PRIDEi
Q9NY84

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83188 [Q9NY84-2]
83189 [Q9NY84-3]
83190 [Q9NY84-4]
83191 [Q9NY84-5]
83192 [Q9NY84-6]
83193 [Q9NY84-7]
83194 [Q9NY84-8]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9NY84, 4 sites

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NY84

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in neutrophils (at protein level) (PubMed:18805469). Detected in liver, peripheral blood leukocytes and placenta (PubMed:11491533). Expressed in differentiated keratinocytes in epidermis and in epithelial cells in dermis (PubMed:19322213). Overexpressed in lesional psoriatic skin (PubMed:19322213).3 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By Th17/Th1 type cytokines, but not by Th2-type.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000093134, Expressed in right lobe of liver and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NY84, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NY84, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000093134, Group enriched (blood, bone marrow, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120630, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440594

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NY84, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NY84

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 274CN hydrolasePROSITE-ProRule annotationAdd BLAST244

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0806, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013823

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_083636_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NY84

Identification of Orthologs from Complete Genome Data

More...
OMAi
WREWNLH

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NY84

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.60.110.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040154, Biotinidase/VNN
IPR003010, C-N_Hydrolase
IPR036526, C-N_Hydrolase_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10609, PTHR10609, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00795, CN_hydrolase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56317, SSF56317, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50263, CN_HYDROLASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NY84-2) [UniParc]FASTAAdd to basket
Also known as: PAGEL-gamma

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIISHFPKCV AVFALLALSV GALDTFIAAV YEHAVILPNR TETPVSKEEA
60 70 80 90 100
LLLMNKNIDV LEKAVKLAAK QGAHIIVTPE DGIYGWIFTR ESIYPYLEDI
110 120 130 140 150
PDPGVNWIPC RDPWRFGNTP VQQRLSCLAK DNSIYVVANI GDKKPCNASD
160 170 180 190 200
SQCPPDGRYQ YNTDVVFDSQ GKLLARYHKY NLFAPEIQFD FPKDSELVTF
210 220 230 240 250
DTPFGKFGIF TCFDIFSHDP AVVVVDEFQL TAFSTPQHGT TRCPSSRLFP
260 270
SIQHGPRPWE SIYLLQIPTT PACT
Length:274
Mass (Da):30,719
Last modified:August 12, 2020 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i916CC9113B516FB7
GO
Isoform 2 (identifier: Q9NY84-3) [UniParc]FASTAAdd to basket
Also known as: PAGEL-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     116-117: FG → NH
     118-274: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:117
Mass (Da):13,111
Checksum:iC7FCDC95155F9DA8
GO
Isoform 3 (identifier: Q9NY84-4) [UniParc]FASTAAdd to basket
Also known as: PAGEL-beta

The sequence of this isoform differs from the canonical sequence as follows:
     116-147: FGNTPVQQRLSCLAKDNSIYVVANIGDKKPCN → KSKKMNEPVSKELCYHCHSECNQYGQWKLYRT
     148-274: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:147
Mass (Da):16,761
Checksum:iD141E2BB62965D2C
GO
Isoform 4 (identifier: Q9NY84-5) [UniParc]FASTAAdd to basket
Also known as: PAGEL-delta

The sequence of this isoform differs from the canonical sequence as follows:
     180-207: YNLFAPEIQFDFPKDSELVTFDTPFGKF → GVESTPQKQSRCTTMTWKQRVVSCCYQN
     208-274: Missing.

Show »
Length:207
Mass (Da):23,210
Checksum:i5E5434A9C83C6474
GO
Isoform 5 (identifier: Q9NY84-6) [UniParc]FASTAAdd to basket
Also known as: PAGEL-epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     115-133: RFGNTPVQQRLSCLAKDNS → STIFLHLKFSLISPRIQNL
     134-274: Missing.

Show »
Length:133
Mass (Da):14,914
Checksum:i4AAE90F35C7818B3
GO
Isoform 6 (identifier: Q9NY84-7) [UniParc]FASTAAdd to basket
Also known as: PAGEL-zeta

The sequence of this isoform differs from the canonical sequence as follows:
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-274: Missing.

Show »
Length:129
Mass (Da):14,481
Checksum:i2928EDC130EDA620
GO
Isoform 7 (identifier: Q9NY84-8) [UniParc]FASTAAdd to basket
Also known as: PAGEL-eta

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: K → KQVLPFYTCKGDLQFGQRVFGIHDKLFCPTCFE
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-274: Missing.

Show »
Length:161
Mass (Da):18,201
Checksum:i89897FB811DC4340
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYI1F5GYI1_HUMAN
Vascular non-inflammatory molecule ...
VNN3
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A669KBD6A0A669KBD6_HUMAN
Vascular non-inflammatory molecule ...
VNN3
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFQ7H0YFQ7_HUMAN
Vascular non-inflammatory molecule ...
VNN3
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB76824 differs from that shown. Reason: Frameshift.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02526533H → R1 PublicationCorresponds to variant dbSNP:rs764264Ensembl.1
Natural variantiVAR_02526689T → A1 PublicationCorresponds to variant dbSNP:rs36012859Ensembl.1
Natural variantiVAR_02526791E → K1 PublicationCorresponds to variant dbSNP:rs12174042Ensembl.1
Natural variantiVAR_025268222V → A2 PublicationsCorresponds to variant dbSNP:rs6569834Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03856170K → KQVLPFYTCKGDLQFGQRVF GIHDKLFCPTCFE in isoform 7. 1 Publication1
Alternative sequenceiVSP_038562115 – 133RFGNT…AKDNS → STIFLHLKFSLISPRIQNL in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_038563116 – 147FGNTP…KKPCN → KSKKMNEPVSKELCYHCHSE CNQYGQWKLYRT in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_038564116 – 129FGNTP…LSCLA → EWNLRPRSSQGVPL in isoform 6 and isoform 7. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_029578116 – 117FG → NH in isoform 2. 2 Publications2
Alternative sequenceiVSP_029579118 – 274Missing in isoform 2. 2 PublicationsAdd BLAST157
Alternative sequenceiVSP_038565130 – 274Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST145
Alternative sequenceiVSP_038566134 – 274Missing in isoform 5. 1 PublicationAdd BLAST141
Alternative sequenceiVSP_038567148 – 274Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_038568180 – 207YNLFA…PFGKF → GVESTPQKQSRCTTMTWKQR VVSCCYQN in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_038569208 – 274Missing in isoform 4. 1 PublicationAdd BLAST67

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB435052 mRNA Translation: BAG30924.1
AB435053 mRNA Translation: BAG30925.1
AB435054 mRNA Translation: BAG30926.1
AB435055 mRNA Translation: BAG30927.1
AB435056 mRNA Translation: BAG30928.1
AB435057 mRNA Translation: BAG30929.1
AB435058 mRNA Translation: BAG30930.1
AB435059 mRNA Translation: BAG30931.1
AB435060 mRNA Translation: BAG30932.1
AB435061 mRNA Translation: BAG30933.1
DQ220706 Genomic DNA Translation: ABA60895.1
AL032821 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48017.1
BC104416 mRNA Translation: AAI04417.1
BC104417 mRNA Translation: AAI04418.1
AJ238982 mRNA Translation: CAB76824.1 Frameshift.

NCBI Reference Sequences

More...
RefSeqi
NP_001278632.1, NM_001291703.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000275223; ENSP00000443073; ENSG00000093134 [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134 [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134 [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134 [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134 [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134 [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134 [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134 [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134 [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134 [Q9NY84-3]
ENST00000674148; ENSP00000501200; ENSG00000093134 [Q9NY84-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55350

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55350

UCSC genome browser

More...
UCSCi
uc011ecl.3, human [Q9NY84-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB435052 mRNA Translation: BAG30924.1
AB435053 mRNA Translation: BAG30925.1
AB435054 mRNA Translation: BAG30926.1
AB435055 mRNA Translation: BAG30927.1
AB435056 mRNA Translation: BAG30928.1
AB435057 mRNA Translation: BAG30929.1
AB435058 mRNA Translation: BAG30930.1
AB435059 mRNA Translation: BAG30931.1
AB435060 mRNA Translation: BAG30932.1
AB435061 mRNA Translation: BAG30933.1
DQ220706 Genomic DNA Translation: ABA60895.1
AL032821 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48017.1
BC104416 mRNA Translation: AAI04417.1
BC104417 mRNA Translation: AAI04418.1
AJ238982 mRNA Translation: CAB76824.1 Frameshift.
RefSeqiNP_001278632.1, NM_001291703.1

3D structure databases

SMRiQ9NY84
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120630, 1 interactor
STRINGi9606.ENSP00000440594

PTM databases

GlyGeniQ9NY84, 4 sites
PhosphoSitePlusiQ9NY84

Genetic variation databases

BioMutaiVNN3
DMDMi88952267

Proteomic databases

jPOSTiQ9NY84
MassIVEiQ9NY84
PaxDbiQ9NY84
PeptideAtlasiQ9NY84
PRIDEiQ9NY84
ProteomicsDBi83188 [Q9NY84-2]
83189 [Q9NY84-3]
83190 [Q9NY84-4]
83191 [Q9NY84-5]
83192 [Q9NY84-6]
83193 [Q9NY84-7]
83194 [Q9NY84-8]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2278, 82 antibodies

The DNASU plasmid repository

More...
DNASUi
55350

Genome annotation databases

EnsembliENST00000275223; ENSP00000443073; ENSG00000093134 [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134 [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134 [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134 [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134 [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134 [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134 [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134 [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134 [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134 [Q9NY84-3]
ENST00000674148; ENSP00000501200; ENSG00000093134 [Q9NY84-3]
GeneIDi55350
KEGGihsa:55350
UCSCiuc011ecl.3, human [Q9NY84-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55350
DisGeNETi55350

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VNN3
HGNCiHGNC:16431, VNN3
HPAiENSG00000093134, Group enriched (blood, bone marrow, liver)
MIMi606592, gene
neXtProtiNX_Q9NY84
OpenTargetsiENSG00000093134
VEuPathDBiHostDB:ENSG00000093134.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0806, Eukaryota
GeneTreeiENSGT00390000013823
HOGENOMiCLU_083636_0_0_1
InParanoidiQ9NY84
OMAiWREWNLH
PhylomeDBiQ9NY84

Enzyme and pathway databases

BRENDAi3.5.1.92, 2681
PathwayCommonsiQ9NY84
ReactomeiR-HSA-163125, Post-translational modification: synthesis of GPI-anchored proteins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55350, 2 hits in 117 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55350
PharosiQ9NY84, Tbio

Protein Ontology

More...
PROi
PR:Q9NY84
RNActiQ9NY84, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000093134, Expressed in right lobe of liver and 129 other tissues
ExpressionAtlasiQ9NY84, baseline and differential
GenevisibleiQ9NY84, HS

Family and domain databases

Gene3Di3.60.110.10, 1 hit
InterProiView protein in InterPro
IPR040154, Biotinidase/VNN
IPR003010, C-N_Hydrolase
IPR036526, C-N_Hydrolase_sf
PANTHERiPTHR10609, PTHR10609, 1 hit
PfamiView protein in Pfam
PF00795, CN_hydrolase, 1 hit
SUPFAMiSSF56317, SSF56317, 1 hit
PROSITEiView protein in PROSITE
PS50263, CN_HYDROLASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVNN3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NY84
Secondary accession number(s): B2DFY0
, B2DFY1, B2DFY3, B2DFY5, B2DFY6, B2DFY7, B2DFY8, Q3SX90, Q9BQY2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: August 12, 2020
Last modified: June 2, 2021
This is version 165 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again