Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9NY27 (PP4R2_HUMAN)

Entry version 144 (29 Sep 2021)
Sequence version 3 (11 Sep 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Serine/threonine-protein phosphatase 4 regulatory subunit 2

Gene

PPP4R2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AX phosphorylated on 'Ser-140' (gamma-H2AX) generated during DNA replication and required for DNA double strand break repair. Mediates RPA2 dephosphorylation by recruiting PPP4C to RPA2 in a DNA damage-dependent manner. RPA2 dephosphorylation is required for the efficient RPA2-mediated recruitment of RAD51 to chromatin following double strand breaks, an essential step for DNA repair.

4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NY27

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5693607, Processing of DNA double-strand break ends

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP4R2
ORF Names:SBBI57
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18296, PPP4R2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613822, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NY27

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000163605

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi99F → A: No effect on RPA2-binding; decrease in PPP4C-binding. 1 Publication1
Mutagenesisi103R → A: No effect on RPA2-binding; loss of PPP4C-binding. 1 Publication1
Mutagenesisi106E → A: No effect on RPA2-binding, nor on PPP4C-binding. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		151987

Open Targets

More...OpenTargetsi		ENSG00000163605

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38520

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NY27, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PPP4R2

Domain mapping of disease mutations (DMDM)

More...DMDMi		158564082

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002993651 – 417Serine/threonine-protein phosphatase 4 regulatory subunit 2Add BLAST417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei159PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NY27

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NY27

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NY27

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NY27

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NY27

PeptideAtlas

More...PeptideAtlasi		Q9NY27

PRoteomics IDEntifications database

More...PRIDEi		Q9NY27

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		83154 [Q9NY27-1]
83155 [Q9NY27-2]
83156 [Q9NY27-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9NY27, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NY27

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9NY27

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NY27

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q9NY27

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163605, Expressed in placenta and 219 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NY27, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NY27, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000163605, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits.

Component of the PP4 complexes PPP4C-PPP4R2, PPP4C-PPP4R2-PPP4R3A and PPP4C-PPP4R2-PPP4R3B. The PPP4C-PPP4R2 complex appears to be a tetramer composed of 2 molecules of PPP4C and 2 molecules of PPP4R2.

Interacts with DDX20/GEMIN3 and GEMIN4.

Interacts with RPA2; this DNA damage-dependent interaction recruits PPP4C leading to RPA2 dephosphorylation.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		127414, 80 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-156, PPP4C-PPP4R2 protein phosphatase 4 complex
CPX-1843, PPP4C-PPP4R2-PPP4R3A protein phosphatase 4 complex
CPX-1844, PPP4C-PPP4R2-PPP4R3B protein phosphatase 4 complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9NY27

Protein interaction database and analysis system

More...IntActi		Q9NY27, 41 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000349124

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NY27, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NY27

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni140 – 417DisorderedSequence analysisAdd BLAST278

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi140 – 173Polar residuesSequence analysisAdd BLAST34
Compositional biasi183 – 201Polar residuesSequence analysisAdd BLAST19
Compositional biasi202 – 216Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi228 – 258Basic and acidic residuesSequence analysisAdd BLAST31
Compositional biasi259 – 279Polar residuesSequence analysisAdd BLAST21
Compositional biasi280 – 297Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi298 – 312Acidic residuesSequence analysisAdd BLAST15
Compositional biasi313 – 334Basic and acidic residuesSequence analysisAdd BLAST22
Compositional biasi349 – 363Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi365 – 396Polar residuesSequence analysisAdd BLAST32
Compositional biasi398 – 417Acidic residuesSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PPP4R2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3175, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160975

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_043908_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NY27

Identification of Orthologs from Complete Genome Data

More...OMAi		PMEDTPV

Database of Orthologous Groups

More...OrthoDBi		774806at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NY27

TreeFam database of animal gene trees

More...TreeFami		TF105561

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015267, PPP4R2

The PANTHER Classification System

More...PANTHERi		PTHR16487, PTHR16487, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09184, PPP4R2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NY27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVERLQEAL KDFEKRGKKE VCPVLDQFLC HVAKTGETMI QWSQFKGYFI 
        60         70         80         90        100
FKLEKVMDDF RTSAPEPRGP PNPNVEYIPF DEMKERILKI VTGFNGIPFT 
       110        120        130        140        150
IQRLCELLTD PRRNYTGTDK FLRGVEKNVM VVSCVYPSSE KNNSNSLNRM 
       160        170        180        190        200
NGVMFPGNSP SYTERSNING PGTPRPLNRP KVSLSAPMTT NGLPESTDSK 
       210        220        230        240        250
EANLQQNEEK NHSDSSTSES EVSSVSPLKN KHPDEDAVEA EGHEVKRLRF 
       260        270        280        290        300
DKEGEVRETA SQTTSSEISS VMVGETEASS SSQDKDKDSR CTRQHCTEED 
       310        320        330        340        350
EEEDEEEEEE SFMTSREMIP ERKNQEKESD DALTVNEETS EENNQMEESD 
       360        370        380        390        400
VSQAEKDLLH SEGSENEGPV SSSSSDCRET EELVGSNSSK TGEILSESSM 
       410 
ENDDEATEVT DEPMEQD
Length:417
Mass (Da):46,898
Last modified:September 11, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i75298CD34A202F40
GO
Isoform 2 (identifier: Q9NY27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-96: MIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNG → I

Show »
Length:360
Mass (Da):40,175
Checksum:i8008773931775213
GO
Isoform 3 (identifier: Q9NY27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.

Show »
Length:361
Mass (Da):40,249
Checksum:i3B1868993A26757A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZ04C9IZ04_HUMAN
Serine/threonine-protein phosphatas...
PPP4R2
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCA1F8WCA1_HUMAN
Serine/threonine-protein phosphatas...
PPP4R2
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C559H7C559_HUMAN
Serine/threonine-protein phosphatas...
PPP4R2
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZF4C9IZF4_HUMAN
HCG14948, isoform CRA_a
PPP4R2 hCG_14948
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDK3F8WDK3_HUMAN
Serine/threonine-protein phosphatas...
PPP4R2
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI00282 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence CAB93534 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051749174P → L. Corresponds to variant dbSNP:rs2306983Ensembl.1
Natural variantiVAR_034811282S → C. Corresponds to variant dbSNP:rs34742137Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0276121 – 56Missing in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_02761339 – 96MIQWS…TGFNG → I in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ271448 mRNA Translation: CAB93534.2 Different initiation.
AF327345 mRNA Translation: AAL56006.1
AK289901 mRNA Translation: BAF82590.1
CH471055 Genomic DNA Translation: EAW65530.1
BC100281 mRNA Translation: AAI00282.1 Sequence problems.
BC110889 mRNA Translation: AAI10890.1
BC128136 mRNA Translation: AAI28137.1
BC128137 mRNA Translation: AAI28138.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2917.1 [Q9NY27-1]

NCBI Reference Sequences

More...RefSeqi		NP_001304954.1, NM_001318025.1 [Q9NY27-2]
NP_001304955.1, NM_001318026.1
NP_001304956.1, NM_001318027.1
NP_777567.1, NM_174907.3 [Q9NY27-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000356692; ENSP00000349124; ENSG00000163605 [Q9NY27-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		151987

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:151987

UCSC genome browser

More...UCSCi		uc003dph.2, human [Q9NY27-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271448 mRNA Translation: CAB93534.2 Different initiation.
AF327345 mRNA Translation: AAL56006.1
AK289901 mRNA Translation: BAF82590.1
CH471055 Genomic DNA Translation: EAW65530.1
BC100281 mRNA Translation: AAI00282.1 Sequence problems.
BC110889 mRNA Translation: AAI10890.1
BC128136 mRNA Translation: AAI28137.1
BC128137 mRNA Translation: AAI28138.1
CCDSiCCDS2917.1 [Q9NY27-1]
RefSeqiNP_001304954.1, NM_001318025.1 [Q9NY27-2]
NP_001304955.1, NM_001318026.1
NP_001304956.1, NM_001318027.1
NP_777567.1, NM_174907.3 [Q9NY27-1]

3D structure databases

SMRiQ9NY27
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127414, 80 interactors
ComplexPortaliCPX-156, PPP4C-PPP4R2 protein phosphatase 4 complex
CPX-1843, PPP4C-PPP4R2-PPP4R3A protein phosphatase 4 complex
CPX-1844, PPP4C-PPP4R2-PPP4R3B protein phosphatase 4 complex
CORUMiQ9NY27
IntActiQ9NY27, 41 interactors
STRINGi9606.ENSP00000349124

PTM databases

GlyGeniQ9NY27, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ9NY27
MetOSiteiQ9NY27
PhosphoSitePlusiQ9NY27
SwissPalmiQ9NY27

Genetic variation databases

BioMutaiPPP4R2
DMDMi158564082

Proteomic databases

EPDiQ9NY27
jPOSTiQ9NY27
MassIVEiQ9NY27
MaxQBiQ9NY27
PaxDbiQ9NY27
PeptideAtlasiQ9NY27
PRIDEiQ9NY27
ProteomicsDBi83154 [Q9NY27-1]
83155 [Q9NY27-2]
83156 [Q9NY27-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		35014, 165 antibodies

The DNASU plasmid repository

More...DNASUi		151987

Genome annotation databases

EnsembliENST00000356692; ENSP00000349124; ENSG00000163605 [Q9NY27-1]
GeneIDi151987
KEGGihsa:151987
UCSCiuc003dph.2, human [Q9NY27-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		151987
DisGeNETi151987

GeneCards: human genes, protein and diseases

More...GeneCardsi		PPP4R2
HGNCiHGNC:18296, PPP4R2
HPAiENSG00000163605, Low tissue specificity
MIMi613822, gene
neXtProtiNX_Q9NY27
OpenTargetsiENSG00000163605
PharmGKBiPA38520
VEuPathDBiHostDB:ENSG00000163605

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3175, Eukaryota
GeneTreeiENSGT00940000160975
HOGENOMiCLU_043908_1_1_1
InParanoidiQ9NY27
OMAiPMEDTPV
OrthoDBi774806at2759
PhylomeDBiQ9NY27
TreeFamiTF105561

Enzyme and pathway databases

PathwayCommonsiQ9NY27
ReactomeiR-HSA-5693607, Processing of DNA double-strand break ends

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		151987, 388 hits in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PPP4R2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		151987
PharosiQ9NY27, Tbio

Protein Ontology

More...PROi		PR:Q9NY27
RNActiQ9NY27, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000163605, Expressed in placenta and 219 other tissues
ExpressionAtlasiQ9NY27, baseline and differential
GenevisibleiQ9NY27, HS

Family and domain databases

InterProiView protein in InterPro
IPR015267, PPP4R2
PANTHERiPTHR16487, PTHR16487, 1 hit
PfamiView protein in Pfam
PF09184, PPP4R2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPP4R2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NY27
Secondary accession number(s): A8K1I6
, Q2TAJ9, Q498B8, Q8WXX6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: September 29, 2021
This is version 144 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again