Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (02 Jun 2021)
Sequence version 3 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Gypsy retrotransposon integrase-like protein 1

Gene

GIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NXP7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gypsy retrotransposon integrase-like protein 1
Short name:
GIN-1
Alternative name(s):
Ty3/Gypsy integrase 1
Zinc finger H2C2 domain-containing protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GIN1
Synonyms:TGIN1, ZH2C2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25959, GIN1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NXP7

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000145723.16

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54826

Open Targets

More...
OpenTargetsi
ENSG00000145723

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162389674

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NXP7, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GIN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439336

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003330161 – 522Gypsy retrotransposon integrase-like protein 1Add BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei502PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NXP7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NXP7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NXP7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NXP7

PeptideAtlas

More...
PeptideAtlasi
Q9NXP7

PRoteomics IDEntifications database

More...
PRIDEi
Q9NXP7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83117 [Q9NXP7-1]
83118 [Q9NXP7-2]
83119 [Q9NXP7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NXP7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NXP7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Also found in tumors originating from parathyroid gland, colon, stomach, bladder, uterus and prostate.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145723, Expressed in biceps brachii and 215 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NXP7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000145723, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120180, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NXP7, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000381970

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NXP7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini135 – 292Integrase catalyticPROSITE-ProRule annotationAdd BLAST158

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0017, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160670

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2589081_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NXP7

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQSEWIG

Database of Orthologous Groups

More...
OrthoDBi
583605at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NXP7

TreeFam database of animal gene trees

More...
TreeFami
TF352301

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.420.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001584, Integrase_cat-core
IPR041588, Integrase_H2C2
IPR012337, RNaseH-like_sf
IPR036397, RNaseH_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17921, Integrase_H2C2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53098, SSF53098, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50994, INTEGRASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NXP7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVRSGKNGDL HLKQIAYYKR TGEYHSTTLP SERSGIRRAA KKFVFKEKKL
60 70 80 90 100
FYVGKDRKQN RLVIVSEEEK KKVLRECHEN DSGAHHGISR TLTLVESNYY
110 120 130 140 150
WTSVTNDVKQ WVYACQHCQV AKNTVIVAPK QHLLKVENPW SLVTVDLMGP
160 170 180 190 200
FHTSNRSHVY AIIMTDLFTK WIVILPLCDV SASEVSKAII NIFFLYGPPQ
210 220 230 240 250
KIIMDQRDEF IQQINIELYR LFGIKQIVIS HTSGTVNPTE STPNTIKAFL
260 270 280 290 300
SKHCADHPNN WDDHLSAVSF AFNVTHLEPT KNTPYFQMFS RNPYMPETSD
310 320 330 340 350
SLHEVDGDNT SMFAKILDAI KEADKIMENK TTSLGQMENN NLDELNKSKI
360 370 380 390 400
IVKKKPKQLN PFHLKVGHEV LRQRKNWWKD GRFQSEWVGP CVIDYITESG
410 420 430 440 450
CAVLRDNTGV RLKRPIKMSH LKPYIRESSE QESLYLLQGS VVADHDYIGL
460 470 480 490 500
PEIPIGAYQA NILVEDATIG IVDNELLTSS KDRELLEYRN TKISPLIDDH
510 520
SSLEKQTFSL LDSSNQVLEY LS
Length:522
Mass (Da):59,842
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5375EC9B009D8B9F
GO
Isoform 2 (identifier: Q9NXP7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-80: EKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHEN → GICLSALPSGKKYSYCSTETAPSQGGKSMEFSYC
     81-522: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:80
Mass (Da):8,891
Checksum:i12EF0D2C163C56EF
GO
Isoform 3 (identifier: Q9NXP7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-222: INIELYRLF → KVFISCKVQ
     223-522: Missing.

Show »
Length:222
Mass (Da):25,703
Checksum:i9241917EAEB27B52
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA90963 differs from that shown. Reason: Frameshift.Curated
The sequence CAH10511 differs from that shown. Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti108V → A in BAA90963 (PubMed:14702039).Curated1
Sequence conflicti313F → L in CAH10511 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04304122G → C1 PublicationCorresponds to variant dbSNP:rs17851289Ensembl.1
Natural variantiVAR_043042239T → M2 PublicationsCorresponds to variant dbSNP:rs34813Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03851847 – 80EKKLF…ECHEN → GICLSALPSGKKYSYCSTET APSQGGKSMEFSYC in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03851981 – 522Missing in isoform 2. 1 PublicationAdd BLAST442
Alternative sequenceiVSP_033438214 – 222INIELYRLF → KVFISCKVQ in isoform 3. 1 Publication9
Alternative sequenceiVSP_033439223 – 522Missing in isoform 3. 1 PublicationAdd BLAST300

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK000132 mRNA Translation: BAA90963.1 Frameshift.
AK295796 mRNA Translation: BAG58616.1
CR627424 mRNA Translation: CAH10511.1 Sequence problems.
AC008447 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW49080.1
BC015325 mRNA Translation: AAH15325.1
BC151135 mRNA Translation: AAI51136.1
BC157835 mRNA Translation: AAI57836.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43349.1 [Q9NXP7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001304883.1, NM_001317954.1
NP_060146.2, NM_017676.2 [Q9NXP7-1]
XP_016865088.1, XM_017009599.1 [Q9NXP7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000399004; ENSP00000381970; ENSG00000145723 [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723 [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723 [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723 [Q9NXP7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54826

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54826

UCSC genome browser

More...
UCSCi
uc003koa.2, human [Q9NXP7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000132 mRNA Translation: BAA90963.1 Frameshift.
AK295796 mRNA Translation: BAG58616.1
CR627424 mRNA Translation: CAH10511.1 Sequence problems.
AC008447 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW49080.1
BC015325 mRNA Translation: AAH15325.1
BC151135 mRNA Translation: AAI51136.1
BC157835 mRNA Translation: AAI57836.1
CCDSiCCDS43349.1 [Q9NXP7-1]
RefSeqiNP_001304883.1, NM_001317954.1
NP_060146.2, NM_017676.2 [Q9NXP7-1]
XP_016865088.1, XM_017009599.1 [Q9NXP7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi120180, 3 interactors
IntActiQ9NXP7, 2 interactors
STRINGi9606.ENSP00000381970

PTM databases

iPTMnetiQ9NXP7
PhosphoSitePlusiQ9NXP7

Genetic variation databases

BioMutaiGIN1
DMDMi296439336

Proteomic databases

jPOSTiQ9NXP7
MassIVEiQ9NXP7
MaxQBiQ9NXP7
PaxDbiQ9NXP7
PeptideAtlasiQ9NXP7
PRIDEiQ9NXP7
ProteomicsDBi83117 [Q9NXP7-1]
83118 [Q9NXP7-2]
83119 [Q9NXP7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
48162, 60 antibodies

The DNASU plasmid repository

More...
DNASUi
54826

Genome annotation databases

EnsembliENST00000399004; ENSP00000381970; ENSG00000145723 [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723 [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723 [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723 [Q9NXP7-2]
GeneIDi54826
KEGGihsa:54826
UCSCiuc003koa.2, human [Q9NXP7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54826
DisGeNETi54826

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GIN1
HGNCiHGNC:25959, GIN1
HPAiENSG00000145723, Low tissue specificity
neXtProtiNX_Q9NXP7
OpenTargetsiENSG00000145723
PharmGKBiPA162389674
VEuPathDBiHostDB:ENSG00000145723.16

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0017, Eukaryota
GeneTreeiENSGT00940000160670
HOGENOMiCLU_2589081_0_0_1
InParanoidiQ9NXP7
OMAiFQSEWIG
OrthoDBi583605at2759
PhylomeDBiQ9NXP7
TreeFamiTF352301

Enzyme and pathway databases

PathwayCommonsiQ9NXP7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
54826, 6 hits in 990 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GIN1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54826
PharosiQ9NXP7, Tdark

Protein Ontology

More...
PROi
PR:Q9NXP7
RNActiQ9NXP7, protein

Gene expression databases

BgeeiENSG00000145723, Expressed in biceps brachii and 215 other tissues
GenevisibleiQ9NXP7, HS

Family and domain databases

Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR001584, Integrase_cat-core
IPR041588, Integrase_H2C2
IPR012337, RNaseH-like_sf
IPR036397, RNaseH_sf
PfamiView protein in Pfam
PF17921, Integrase_H2C2, 1 hit
SUPFAMiSSF53098, SSF53098, 1 hit
PROSITEiView protein in PROSITE
PS50994, INTEGRASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGIN1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NXP7
Secondary accession number(s): B2RXF7
, B4DIV4, Q6AI03, Q96BR2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 18, 2010
Last modified: June 2, 2021
This is version 134 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again