Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centlein

Gene

CNTLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for centrosome cohesion and recruitment of CEP68 to centrosomes.1 Publication

GO - Molecular functioni

  • protein binding, bridging Source: UniProtKB
  • protein domain specific binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • centriole-centriole cohesion Source: UniProtKB
  • protein localization to organelle Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
Centlein
Alternative name(s):
Centrosomal protein
Gene namesi
Name:CNTLN
Synonyms:C9orf101, C9orf39
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000044459.14
HGNCiHGNC:23432 CNTLN
MIMi611870 gene
neXtProtiNX_Q9NXG0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi54875
OpenTargetsiENSG00000044459
PharmGKBiPA162382646

Polymorphism and mutation databases

BioMutaiCNTLN
DMDMi317373585

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002275672 – 1405CentleinAdd BLAST1404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei5PhosphoserineBy similarity1
Modified residuei22PhosphoserineCombined sources1
Modified residuei1343PhosphothreonineBy similarity1

Post-translational modificationi

Phosphorylated directly or indirectly by NEK2.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9NXG0
MaxQBiQ9NXG0
PaxDbiQ9NXG0
PeptideAtlasiQ9NXG0
PRIDEiQ9NXG0
ProteomicsDBi83091
83092 [Q9NXG0-2]
83093 [Q9NXG0-3]

PTM databases

CarbonylDBiQ9NXG0
iPTMnetiQ9NXG0
PhosphoSitePlusiQ9NXG0

Expressioni

Gene expression databases

BgeeiENSG00000044459
CleanExiHS_CNTLN
GenevisibleiQ9NXG0 HS

Organism-specific databases

HPAiHPA007201
HPA036728
HPA036729

Interactioni

Subunit structurei

Interacts with CEP250 and CEP68. Interacts with NEK2; the interaction leads to phosphorylation of CNTLN.1 Publication

GO - Molecular functioni

  • protein binding, bridging Source: UniProtKB
  • protein domain specific binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120223, 13 interactors
DIPiDIP-47295N
IntActiQ9NXG0, 10 interactors
STRINGi9606.ENSP00000370021

Structurei

3D structure databases

SMRiQ9NXG0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili95 – 126Sequence analysisAdd BLAST32
Coiled coili613 – 655Sequence analysisAdd BLAST43
Coiled coili681 – 793Sequence analysisAdd BLAST113
Coiled coili980 – 1311Sequence analysisAdd BLAST332

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1398 – 1405Poly-Ser8

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IHKZ Eukaryota
ENOG410XRNE LUCA
GeneTreeiENSGT00440000034932
HOGENOMiHOG000111849
HOVERGENiHBG107737
InParanoidiQ9NXG0
KOiK16467
OMAiCFETTKS
OrthoDBiEOG091G0JYN
PhylomeDBiQ9NXG0
TreeFamiTF329190

Family and domain databases

InterProiView protein in InterPro
IPR038810 CNTLN
PANTHERiPTHR18957 PTHR18957, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NXG0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAARSPPSPH PSPPARQLGP RSPRVGRGAE VHAMRSEASG FAGAAREVVA
60 70 80 90 100
DESDKIWVGE EGSGGRRGPG GAAPAHAPLL SAPMGSRRLE GISVEEAMVT
110 120 130 140 150
RTQLLEEELS SLKEELALCQ ADKEFVWSLW KRLQVTNPDL TQVVSLVVER
160 170 180 190 200
EKQKSEAKDR KVLEILQVKD AKIQEFEQRE SVLKQEINDL VKRKIAVDEE
210 220 230 240 250
NAFLRKEFSD LEKKFKDKSQ EIKDTKECVQ NKEEQNRLVI KNLEEENKKL
260 270 280 290 300
STRCTDLLND LEKLRKQEAH LRKEKYSTDA KIKTFEDNLI EARKEVEVSQ
310 320 330 340 350
SKYNALSLQL SNKQTELIQK DMDITLVRKE LQELQNLYKQ NSTHTAQQAE
360 370 380 390 400
LIQQLQVLNM DTQKVLRNQE DVHTAESISY QKLYNELHIC FETTKSNEAM
410 420 430 440 450
LRQSVTNLQD QLLQKEQENA KLKEKLQESQ GAPLPLPQES DPDYSAQVPH
460 470 480 490 500
RPSLSSLETL MVSQKSEIEY LQEKLKIANE KLSENISANK GFSRKSIMTS
510 520 530 540 550
AEGKHKEPPV KRSRSLSPKS SFTDSEELQK LRKAERKIEN LEKALQLKSQ
560 570 580 590 600
ENDELRDAHE KRKERLQMLQ TNYRAVKEQL KQWEEGSGMT EIRKIKRADP
610 620 630 640 650
QQLRQEDSDA VWNELAYFKR ENQELMIQKM NLEEELDELK VHISIDKAAI
660 670 680 690 700
QELNRCVAER REEQLFRSGE DDEVKRSTPE KNGKEMLEQT LQKVTELENR
710 720 730 740 750
LKSFEKRSRK LKEGNKKLMK ENDFLKSLLK QQQEDTETRE KELEQIIKGS
760 770 780 790 800
KDVEKENTEL QVKISELETE VTSLRRQVAE ANALRNENEE LINPMEKSHQ
810 820 830 840 850
SADRAKSEMA TMKVRSGRYD CKTTMTKVKF KAAKKNCSVG RHHTVLNHSI
860 870 880 890 900
KVMSNVFENL SKDGWEDVSE SSSDSEAQTS QTLGTIIVET SQKISPTEDG
910 920 930 940 950
KDQKESDPTE DSQTQGKEIV QTYLNIDGKT PKDYFHDKNA KKPTFQKKNC
960 970 980 990 1000
KMQKSSHTAV PTRVNREKYK NITAQKSSSN IILLRERIIS LQQQNSVLQN
1010 1020 1030 1040 1050
AKKTAELSVK EYKEVNEKLL HQQQVSDQRF QTSRQTIKKL NLDLAGLRKE
1060 1070 1080 1090 1100
KEDLLKKLES SSEITSLAEE NSQVTFPRIQ VTSLSPSRSM DLEMKQLQYK
1110 1120 1130 1140 1150
LKNATNELTK QSSNVKTLKF ELLAKEEHIK EMHEKISRME RDITMKRHLI
1160 1170 1180 1190 1200
EDLKFRQKVN LESNKSFSEM LQNLDKKVKT LTEECSNKKV SIDSLKQRLN
1210 1220 1230 1240 1250
VAVKEKSQYE QMYQKSKEEL EKKDLKLTLL VSRISETESA MAEIETAASK
1260 1270 1280 1290 1300
QLQELALQSE QVLEGAQKTL LLANEKVEEF TTFVKALAKE LQNDVHVVRR
1310 1320 1330 1340 1350
QIRELKKMKK NRDACKTSTH KAQTLAASIL NISRSDLEEI LDTEDQVEIE
1360 1370 1380 1390 1400
KTKIDAENDK EWMLYIQKLL EGQSLTLSPR LKCNGAIMAH QNLRLPDSSS

SASAS
Note: No experimental confirmation available.
Length:1,405
Mass (Da):161,603
Last modified:January 11, 2011 - v5
Checksum:i6161171F6995E843
GO
Isoform 2 (identifier: Q9NXG0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1374-1405: SLTLSPRLKCNGAIMAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR

Note: No experimental confirmation available.
Show »
Length:1,406
Mass (Da):162,190
Checksum:i6F6D3FAA60C90837
GO
Isoform 3 (identifier: Q9NXG0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     383-391: LYNELHICF → VCFYSVIKM
     392-1405: Missing.

Note: No experimental confirmation available.
Show »
Length:391
Mass (Da):44,587
Checksum:i2D42ACFC8A710C21
GO

Sequence cautioni

The sequence BAA91052 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB13850 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti700R → Q in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti871Missing in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti1004T → A in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti1240A → V in BAB13850 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056840284T → A. Corresponds to variant dbSNP:rs3808795Ensembl.1
Natural variantiVAR_056841291E → D. Corresponds to variant dbSNP:rs3808794Ensembl.1
Natural variantiVAR_025608562R → C. Corresponds to variant dbSNP:rs3808782Ensembl.1
Natural variantiVAR_025609695T → I1 PublicationCorresponds to variant dbSNP:rs7035276Ensembl.1
Natural variantiVAR_0256101376T → A. Corresponds to variant dbSNP:rs2499057Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032864383 – 391LYNELHICF → VCFYSVIKM in isoform 3. 1 Publication9
Alternative sequenceiVSP_032865392 – 1405Missing in isoform 3. 1 PublicationAdd BLAST1014
Alternative sequenceiVSP_0175581374 – 1405SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2. CuratedAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000283 mRNA Translation: BAA91052.1 Different initiation.
AK021596 mRNA Translation: BAB13850.1 Different initiation.
AK098502 mRNA Translation: BAC05319.1
AL133214 Genomic DNA No translation available.
AL162725 Genomic DNA No translation available.
AL354711 Genomic DNA No translation available.
AL354738 Genomic DNA No translation available.
AL590377 Genomic DNA No translation available.
CCDSiCCDS43789.1 [Q9NXG0-2]
CCDS47953.1 [Q9NXG0-3]
RefSeqiNP_001107867.1, NM_001114395.2 [Q9NXG0-3]
NP_060208.2, NM_017738.3 [Q9NXG0-2]
UniGeneiHs.435381

Genome annotation databases

EnsembliENST00000380641; ENSP00000370015; ENSG00000044459 [Q9NXG0-3]
ENST00000380647; ENSP00000370021; ENSG00000044459 [Q9NXG0-2]
GeneIDi54875
KEGGihsa:54875
UCSCiuc003zmx.6 human [Q9NXG0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCNTLN_HUMAN
AccessioniPrimary (citable) accession number: Q9NXG0
Secondary accession number(s): A5Z2X6
, Q5VYJ0, Q8N1G9, Q9HAJ5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: January 11, 2011
Last modified: July 18, 2018
This is version 124 of the entry and version 5 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health