Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (22 Apr 2020)
Sequence version 6 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Centlein

Gene

CNTLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for centrosome cohesion and recruitment of CEP68 to centrosomes.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein binding, bridging Source: UniProtKB
  • protein domain specific binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centlein
Alternative name(s):
Centrosomal protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CNTLN
Synonyms:C9orf101, C9orf39
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23432 CNTLN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611870 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NXG0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54875

Open Targets

More...
OpenTargetsi
ENSG00000044459

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162382646

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NXG0 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CNTLN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373585

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002275672 – 1405CentleinAdd BLAST1404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei5PhosphoserineBy similarity1
Modified residuei22PhosphoserineCombined sources1
Modified residuei1343PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated directly or indirectly by NEK2.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NXG0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NXG0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NXG0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NXG0

PeptideAtlas

More...
PeptideAtlasi
Q9NXG0

PRoteomics IDEntifications database

More...
PRIDEi
Q9NXG0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
83091 [Q9NXG0-1]
83092 [Q9NXG0-2]
83093 [Q9NXG0-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q9NXG0

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NXG0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NXG0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000044459 Expressed in buccal mucosa cell and 143 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NXG0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000044459 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CEP250 and CEP68.

Interacts with NEK2; the interaction leads to phosphorylation of CNTLN.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120223, 15 interactors

Database of interacting proteins

More...
DIPi
DIP-47295N

Protein interaction database and analysis system

More...
IntActi
Q9NXG0, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370021

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NXG0 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NXG0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili95 – 126Sequence analysisAdd BLAST32
Coiled coili613 – 655Sequence analysisAdd BLAST43
Coiled coili681 – 793Sequence analysisAdd BLAST113
Coiled coili980 – 1311Sequence analysisAdd BLAST332

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1398 – 1405Poly-Ser8

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHKZ Eukaryota
ENOG410XRNE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000034932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006488_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NXG0

KEGG Orthology (KO)

More...
KOi
K16467

Identification of Orthologs from Complete Genome Data

More...
OMAi
MSNMFEN

Database of Orthologous Groups

More...
OrthoDBi
846281at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NXG0

TreeFam database of animal gene trees

More...
TreeFami
TF329190

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038810 CNTLN

The PANTHER Classification System

More...
PANTHERi
PTHR18957 PTHR18957, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NXG0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARSPPSPH PSPPARQLGP RSPRVGRGAE VHAMRSEASG FAGAAREVVA
60 70 80 90 100
DESDKIWVGE EGSGGRRGPG GAAPAHAPLL SAPMGSRRLE GISVEEAMVT
110 120 130 140 150
RTQLLEEELS SLKEELALCQ ADKEFVWSLW KRLQVTNPDL TQVVSLVVER
160 170 180 190 200
EKQKSEAKDR KVLEILQVKD AKIQEFEQRE SVLKQEINDL VKRKIAVDEE
210 220 230 240 250
NAFLRKEFSD LEKKFKDKSQ EIKDTKECVQ NKEEQNRLVI KNLEEENKKL
260 270 280 290 300
STRCTDLLND LEKLRKQEAH LRKEKYSTDA KIKTFEDNLI EARKEVEVSQ
310 320 330 340 350
SKYNALSLQL SNKQTELIQK DMDITLVRKE LQELQNLYKQ NSTHTAQQAE
360 370 380 390 400
LIQQLQVLNM DTQKVLRNQE DVHTAESISY QKLYNELHIC FETTKSNEAM
410 420 430 440 450
LRQSVTNLQD QLLQKEQENA KLKEKLQESQ GAPLPLPQES DPDYSAQVPH
460 470 480 490 500
RPSLSSLETL MVSQKSEIEY LQEKLKIANE KLSENISANK GFSRKSIMTS
510 520 530 540 550
AEGKHKEPPV KRSRSLSPKS SFTDSEELQK LRKAERKIEN LEKALQLKSQ
560 570 580 590 600
ENDELRDAHE KRKERLQMLQ TNYRAVKEQL KQWEEGSGMT EIRKIKRADP
610 620 630 640 650
QQLRQEDSDA VWNELAYFKR ENQELMIQKM NLEEELDELK VHISIDKAAI
660 670 680 690 700
QELNRCVAER REEQLFRSGE DDEVKRSTPE KNGKEMLEQT LQKVTELENR
710 720 730 740 750
LKSFEKRSRK LKEGNKKLMK ENDFLKSLLK QQQEDTETRE KELEQIIKGS
760 770 780 790 800
KDVEKENTEL QVKISELETE VTSLRRQVAE ANALRNENEE LINPMEKSHQ
810 820 830 840 850
SADRAKSEMA TMKVRSGRYD CKTTMTKVKF KAAKKNCSVG RHHTVLNHSI
860 870 880 890 900
KVMSNVFENL SKDGWEDVSE SSSDSEAQTS QTLGTIIVET SQKISPTEDG
910 920 930 940 950
KDQKESDPTE DSQTQGKEIV QTYLNIDGKT PKDYFHDKNA KKPTFQKKNC
960 970 980 990 1000
KMQKSSHTAV PTRVNREKYK NITAQKSSSN IILLRERIIS LQQQNSVLQN
1010 1020 1030 1040 1050
AKKTAELSVK EYKEVNEKLL HQQQVSDQRF QTSRQTIKKL NLDLAGLRKE
1060 1070 1080 1090 1100
KEDLLKKLES SSEITSLAEE NSQVTFPRIQ VTSLSPSRSM DLEMKQLQYK
1110 1120 1130 1140 1150
LKNATNELTK QSSNVKTLKF ELLAKEEHIK EMHEKISRME RDITMKRHLI
1160 1170 1180 1190 1200
EDLKFRQKVN LESNKSFSEM LQNLDKKVKT LTEECSNKKV SIDSLKQRLN
1210 1220 1230 1240 1250
VAVKEKSQYE QMYQKSKEEL EKKDLKLTLL VSRISETESA MAEIETAASK
1260 1270 1280 1290 1300
QLQELALQSE QVLEGAQKTL LLANEKVEEF TTFVKALAKE LQNDVHVVRR
1310 1320 1330 1340 1350
QIRELKKMKK NRDACKTSTH KAQTLAASIL NISRSDLEEI LDTEDQVEIE
1360 1370 1380 1390 1400
KTKIDAENDK EWMLYIQKLL EGQSLTLSPR LKCNGAIVAH QNLRLPDSSS

SASAS
Length:1,405
Mass (Da):161,571
Last modified:September 12, 2018 - v6
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6170160F6995E843
GO
Isoform 2 (identifier: Q9NXG0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1374-1405: SLTLSPRLKCNGAIVAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR

Show »
Length:1,406
Mass (Da):162,190
Checksum:i6F6D3FAA60C90837
GO
Isoform 3 (identifier: Q9NXG0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     383-391: LYNELHICF → VCFYSVIKM
     392-1405: Missing.

Show »
Length:391
Mass (Da):44,587
Checksum:i2D42ACFC8A710C21
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91052 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB13850 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti700R → Q in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti871Missing in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti1004T → A in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti1240A → V in BAB13850 (PubMed:14702039).Curated1
Sequence conflicti1388V → M in BAA91052 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056840284T → A. Corresponds to variant dbSNP:rs3808795Ensembl.1
Natural variantiVAR_056841291E → D. Corresponds to variant dbSNP:rs3808794Ensembl.1
Natural variantiVAR_025608562R → C. Corresponds to variant dbSNP:rs3808782Ensembl.1
Natural variantiVAR_025609695T → I1 PublicationCorresponds to variant dbSNP:rs7035276Ensembl.1
Natural variantiVAR_0256101376T → A. Corresponds to variant dbSNP:rs2499057Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_032864383 – 391LYNELHICF → VCFYSVIKM in isoform 3. 1 Publication9
Alternative sequenceiVSP_032865392 – 1405Missing in isoform 3. 1 PublicationAdd BLAST1014
Alternative sequenceiVSP_0175581374 – 1405SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2. CuratedAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK000283 mRNA Translation: BAA91052.1 Different initiation.
AK021596 mRNA Translation: BAB13850.1 Different initiation.
AK098502 mRNA Translation: BAC05319.1
AL133214 Genomic DNA No translation available.
AL162725 Genomic DNA No translation available.
AL354711 Genomic DNA No translation available.
AL354738 Genomic DNA No translation available.
AL590377 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43789.1 [Q9NXG0-2]
CCDS47953.1 [Q9NXG0-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001107867.1, NM_001114395.2 [Q9NXG0-3]
NP_060208.2, NM_017738.3 [Q9NXG0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380641; ENSP00000370015; ENSG00000044459 [Q9NXG0-3]
ENST00000380647; ENSP00000370021; ENSG00000044459 [Q9NXG0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54875

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54875

UCSC genome browser

More...
UCSCi
uc003zmx.6 human [Q9NXG0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000283 mRNA Translation: BAA91052.1 Different initiation.
AK021596 mRNA Translation: BAB13850.1 Different initiation.
AK098502 mRNA Translation: BAC05319.1
AL133214 Genomic DNA No translation available.
AL162725 Genomic DNA No translation available.
AL354711 Genomic DNA No translation available.
AL354738 Genomic DNA No translation available.
AL590377 Genomic DNA No translation available.
CCDSiCCDS43789.1 [Q9NXG0-2]
CCDS47953.1 [Q9NXG0-3]
RefSeqiNP_001107867.1, NM_001114395.2 [Q9NXG0-3]
NP_060208.2, NM_017738.3 [Q9NXG0-2]

3D structure databases

SMRiQ9NXG0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120223, 15 interactors
DIPiDIP-47295N
IntActiQ9NXG0, 12 interactors
STRINGi9606.ENSP00000370021

PTM databases

CarbonylDBiQ9NXG0
iPTMnetiQ9NXG0
PhosphoSitePlusiQ9NXG0

Polymorphism and mutation databases

BioMutaiCNTLN
DMDMi317373585

Proteomic databases

EPDiQ9NXG0
jPOSTiQ9NXG0
MassIVEiQ9NXG0
PaxDbiQ9NXG0
PeptideAtlasiQ9NXG0
PRIDEiQ9NXG0
ProteomicsDBi83091 [Q9NXG0-1]
83092 [Q9NXG0-2]
83093 [Q9NXG0-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24606 84 antibodies

The DNASU plasmid repository

More...
DNASUi
54875

Genome annotation databases

EnsembliENST00000380641; ENSP00000370015; ENSG00000044459 [Q9NXG0-3]
ENST00000380647; ENSP00000370021; ENSG00000044459 [Q9NXG0-2]
GeneIDi54875
KEGGihsa:54875
UCSCiuc003zmx.6 human [Q9NXG0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54875
DisGeNETi54875

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CNTLN
HGNCiHGNC:23432 CNTLN
HPAiENSG00000044459 Low tissue specificity
MIMi611870 gene
neXtProtiNX_Q9NXG0
OpenTargetsiENSG00000044459
PharmGKBiPA162382646

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHKZ Eukaryota
ENOG410XRNE LUCA
GeneTreeiENSGT00440000034932
HOGENOMiCLU_006488_1_0_1
InParanoidiQ9NXG0
KOiK16467
OMAiMSNMFEN
OrthoDBi846281at2759
PhylomeDBiQ9NXG0
TreeFamiTF329190

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CNTLN human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CNTLN

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54875
PharosiQ9NXG0 Tbio

Protein Ontology

More...
PROi
PR:Q9NXG0
RNActiQ9NXG0 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000044459 Expressed in buccal mucosa cell and 143 other tissues
GenevisibleiQ9NXG0 HS

Family and domain databases

InterProiView protein in InterPro
IPR038810 CNTLN
PANTHERiPTHR18957 PTHR18957, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNTLN_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NXG0
Secondary accession number(s): A5Z2X6
, Q5VYJ0, Q8N1G9, Q9HAJ5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: September 12, 2018
Last modified: April 22, 2020
This is version 136 of the entry and version 6 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again