Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (29 Sep 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Spermine oxidase

Gene

SMOX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N1-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADBy similarityNote: Binds 1 FAD per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited at more than 90% by SL-11144, SL-11150 and SL-11158, at concentrations less than 1 µM.

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat is 27-fold higher with spermine than N1-acetylspermine as substrate for isoform 1 and isoform 6.
  1. KM=0.6 µM for spermine (isoform 1)3 Publications
  2. KM=0.5 µM for spermine (isoform 6)3 Publications
  3. KM=3.0 µM for N1-acetylspermine (Isoform 1 and isoform 6)3 Publications

pH dependencei

Optimum pH is 9.5 with spermine as substrate.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: spermine degradation

This protein is involved in the pathway spermine degradation, which is part of Amine and polyamine degradation.1 Publication
View all proteins of this organism that are known to be involved in the pathway spermine degradation and in Amine and polyamine degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei35FAD; via amide nitrogenBy similarity1
Binding sitei55FADBy similarity1
Binding sitei63FADBy similarity1
Binding sitei261FAD; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei519FAD; via amide nitrogenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi79 – 80FADBy similarity2
Nucleotide bindingi528 – 529FADBy similarity2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
LigandFAD, Flavoprotein

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS01609-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.5.3.16, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NWM0

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-141334, PAOs oxidise polyamines to amines [Q9NWM0-3]
R-HSA-351200, Interconversion of polyamines [Q9NWM0-3]

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q9NWM0

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00211

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Spermine oxidase (EC:1.5.3.162 Publications)
Alternative name(s):
Polyamine oxidase 1
Short name:
PAO-1
Short name:
PAOh1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SMOX
Synonyms:C20orf16, SMO
ORF Names:UNQ3039/PRO9854
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15862, SMOX

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615854, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NWM0

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000088826

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi320C → R: No change in enzymatic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
54498

Open Targets

More...
OpenTargetsi
ENSG00000088826

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25701

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NWM0, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2176769

Drug and drug target database

More...
DrugBanki
DB04188, MDL72527
DB00127, Spermine

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SMOX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50401688

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000998771 – 555Spermine oxidaseAdd BLAST555

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NWM0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NWM0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NWM0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NWM0

PeptideAtlas

More...
PeptideAtlasi
Q9NWM0

PRoteomics IDEntifications database

More...
PRIDEi
Q9NWM0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
82946 [Q9NWM0-1]
82947 [Q9NWM0-2]
82948 [Q9NWM0-3]
82949 [Q9NWM0-4]
82950 [Q9NWM0-5]
82951 [Q9NWM0-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NWM0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NWM0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in human tumor cell lines. Isoform 4 is only found in an embryonal kidney cell line.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By antitumor polyamine analogs.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000088826, Expressed in nucleus accumbens and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NWM0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NWM0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000088826, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119994, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NWM0, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000478305

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9NWM0

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NWM0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NWM0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni271 – 306DisorderedSequence analysisAdd BLAST36

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi272 – 306Basic and acidic residuesSequence analysisAdd BLAST35

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the flavin monoamine oxidase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0685, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157511

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004498_2_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NWM0

Identification of Orthologs from Complete Genome Data

More...
OMAi
FWSSECN

Database of Orthologous Groups

More...
OrthoDBi
508351at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NWM0

TreeFam database of animal gene trees

More...
TreeFami
TF318348

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.50.50.60, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002937, Amino_oxidase
IPR036188, FAD/NAD-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01593, Amino_oxidase, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51905, SSF51905, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: The resultant proteins have different biochemical characteristics and substrate specificity.

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NWM0-1) [UniParc]FASTAAdd to basket
Also known as: PAOh1, SMO

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQSCESSGDS ADDPLSRGLR RRGQPRVVVI GAGLAGLAAA KALLEQGFTD
60 70 80 90 100
VTVLEASSHI GGRVQSVKLG HATFELGATW IHGSHGNPIY HLAEANGLLE
110 120 130 140 150
ETTDGERSVG RISLYSKNGV ACYLTNHGRR IPKDVVEEFS DLYNEVYNLT
160 170 180 190 200
QEFFRHDKPV NAESQNSVGV FTREEVRNRI RNDPDDPEAT KRLKLAMIQQ
210 220 230 240 250
YLKVESCESS SHSMDEVSLS AFGEWTEIPG AHHIIPSGFM RVVELLAEGI
260 270 280 290 300
PAHVIQLGKP VRCIHWDQAS ARPRGPEIEP RGEGDHNHDT GEGGQGGEEP
310 320 330 340 350
RGGRWDEDEQ WSVVVECEDC ELIPADHVIV TVSLGVLKRQ YTSFFRPGLP
360 370 380 390 400
TEKVAAIHRL GIGTTDKIFL EFEEPFWGPE CNSLQFVWED EAESHTLTYP
410 420 430 440 450
PELWYRKICG FDVLYPPERY GHVLSGWICG EEALVMEKCD DEAVAEICTE
460 470 480 490 500
MLRQFTGNPN IPKPRRILRS AWGSNPYFRG SYSYTQVGSS GADVEKLAKP
510 520 530 540 550
LPYTESSKTA PMQVLFSGEA THRKYYSTTH GALLSGQREA ARLIEMYRDL

FQQGT
Note: Low affinity for acetylated polyamine.
Length:555
Mass (Da):61,819
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBDBEA65ECE9F45BF
GO
Isoform 2 (identifier: Q9NWM0-2) [UniParc]FASTAAdd to basket
Also known as: PAOh2

The sequence of this isoform differs from the canonical sequence as follows:
     282-334: Missing.

Note: Low affinity for acetylated polyamine.Curated
Show »
Length:502
Mass (Da):56,091
Checksum:i45921536D1B92403
GO
Isoform 3 (identifier: Q9NWM0-3) [UniParc]FASTAAdd to basket
Also known as: PAOh3

The sequence of this isoform differs from the canonical sequence as follows:
     146-510: Missing.

Note: Major isoform. Has the highest affinity for the 3 substrates. Has a greater affinity for spermidine and spermine than for N1-acetylspermine.Curated
Show »
Length:190
Mass (Da):20,630
Checksum:iC6A51E1B71E3A56A
GO
Isoform 4 (identifier: Q9NWM0-4) [UniParc]FASTAAdd to basket
Also known as: PAOh4

The sequence of this isoform differs from the canonical sequence as follows:
     282-334: Missing.
     510-510: A → AHGSSTKQQPGHLFSSKCPEQPLDANRGAVK

Note: Has the lowest Km values for the different substrates and has the highest affinity for spermidine.Curated
Show »
Length:532
Mass (Da):59,279
Checksum:iB9AE5FCB9B7762B3
GO
Isoform 5 (identifier: Q9NWM0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-196: Missing.
     510-510: A → AHGSSTKQQPGHLFSSKCPEQPLDANRGAVK

Note: Does not seem to display oxidase activity towards spermidine or N1-acetyl-spermine, but this has to be confirmed.Curated
Show »
Length:389
Mass (Da):43,553
Checksum:iF8AF920F5B10EBA9
GO
Isoform 6 (identifier: Q9NWM0-6) [UniParc]FASTAAdd to basket
Also known as: SMO5, SMOX5

The sequence of this isoform differs from the canonical sequence as follows:
     510-510: A → AHGSSTKQQPGHLFSSKCPEQPLDANRGAVK

Note: Substrate specificities and affinities comparable to those of isoform 1.Curated
Show »
Length:585
Mass (Da):65,007
Checksum:i7B1744F671906B9B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5TE25Q5TE25_HUMAN
Spermine oxidase
SMOX
442Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16S → R in AAK55764 (PubMed:12398765).Curated1
Sequence conflicti60I → V in AAK55765 (PubMed:12398765).Curated1
Sequence conflicti156H → Y in AAK55764 (PubMed:12398765).Curated1
Sequence conflicti290T → A in BAB15288 (PubMed:14702039).Curated1
Sequence conflicti320C → R in AAK55763 (PubMed:11454677).Curated1
Sequence conflicti320C → R in ABM01872 (PubMed:18422650).Curated1
Sequence conflicti372F → L in AAN77119 (PubMed:12398765).Curated1
Sequence conflicti431E → G in AAN77119 (PubMed:12398765).Curated1
Sequence conflicti431E → G in ABM01872 (PubMed:18422650).Curated1
Sequence conflicti504T → A in AAK55764 (PubMed:12398765).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059114301R → P. Corresponds to variant dbSNP:rs6084654Ensembl.1
Natural variantiVAR_036546340Q → K in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_019531522H → Y1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0111231 – 196Missing in isoform 5. 1 PublicationAdd BLAST196
Alternative sequenceiVSP_011124146 – 510Missing in isoform 3. 1 PublicationAdd BLAST365
Alternative sequenceiVSP_011125282 – 334Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_011126510A → AHGSSTKQQPGHLFSSKCPE QPLDANRGAVK in isoform 4, isoform 5 and isoform 6. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY033889 mRNA Translation: AAK55763.1
AY033890 mRNA Translation: AAK55764.1
AY033891 mRNA Translation: AAK55765.1
AF519179 mRNA Translation: AAN77119.1
EF032141 mRNA Translation: ABM01872.1
AY358104 mRNA Translation: AAQ88471.1
AK000753 mRNA Translation: BAA91360.1
AK025938 mRNA Translation: BAB15288.1
AL121675 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10460.1
CH471133 Genomic DNA Translation: EAX10461.1
CH471133 Genomic DNA Translation: EAX10457.1
CH471133 Genomic DNA Translation: EAX10458.1
CH471133 Genomic DNA Translation: EAX10459.1
CH471133 Genomic DNA Translation: EAX10462.1
BC000669 mRNA Translation: AAH00669.1
AL162058 mRNA Translation: CAB82396.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13075.1 [Q9NWM0-1]
CCDS13076.1 [Q9NWM0-2]
CCDS13077.1 [Q9NWM0-3]
CCDS13078.1 [Q9NWM0-4]
CCDS74702.1 [Q9NWM0-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
T47142

NCBI Reference Sequences

More...
RefSeqi
NP_001257620.1, NM_001270691.1 [Q9NWM0-6]
NP_787033.1, NM_175839.2 [Q9NWM0-1]
NP_787034.1, NM_175840.2 [Q9NWM0-2]
NP_787035.1, NM_175841.2 [Q9NWM0-3]
NP_787036.1, NM_175842.2 [Q9NWM0-4]
XP_011527563.1, XM_011529261.2 [Q9NWM0-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278795; ENSP00000278795; ENSG00000088826 [Q9NWM0-4]
ENST00000305958; ENSP00000307252; ENSG00000088826 [Q9NWM0-1]
ENST00000339123; ENSP00000344595; ENSG00000088826 [Q9NWM0-2]
ENST00000346595; ENSP00000341775; ENSG00000088826 [Q9NWM0-3]
ENST00000379460; ENSP00000368773; ENSG00000088826 [Q9NWM0-1]
ENST00000621355; ENSP00000478305; ENSG00000088826 [Q9NWM0-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54498

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54498

UCSC genome browser

More...
UCSCi
uc002wkk.2, human [Q9NWM0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY033889 mRNA Translation: AAK55763.1
AY033890 mRNA Translation: AAK55764.1
AY033891 mRNA Translation: AAK55765.1
AF519179 mRNA Translation: AAN77119.1
EF032141 mRNA Translation: ABM01872.1
AY358104 mRNA Translation: AAQ88471.1
AK000753 mRNA Translation: BAA91360.1
AK025938 mRNA Translation: BAB15288.1
AL121675 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10460.1
CH471133 Genomic DNA Translation: EAX10461.1
CH471133 Genomic DNA Translation: EAX10457.1
CH471133 Genomic DNA Translation: EAX10458.1
CH471133 Genomic DNA Translation: EAX10459.1
CH471133 Genomic DNA Translation: EAX10462.1
BC000669 mRNA Translation: AAH00669.1
AL162058 mRNA Translation: CAB82396.1
CCDSiCCDS13075.1 [Q9NWM0-1]
CCDS13076.1 [Q9NWM0-2]
CCDS13077.1 [Q9NWM0-3]
CCDS13078.1 [Q9NWM0-4]
CCDS74702.1 [Q9NWM0-6]
PIRiT47142
RefSeqiNP_001257620.1, NM_001270691.1 [Q9NWM0-6]
NP_787033.1, NM_175839.2 [Q9NWM0-1]
NP_787034.1, NM_175840.2 [Q9NWM0-2]
NP_787035.1, NM_175841.2 [Q9NWM0-3]
NP_787036.1, NM_175842.2 [Q9NWM0-4]
XP_011527563.1, XM_011529261.2 [Q9NWM0-6]

3D structure databases

SMRiQ9NWM0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi119994, 10 interactors
IntActiQ9NWM0, 7 interactors
STRINGi9606.ENSP00000478305

Chemistry databases

BindingDBiQ9NWM0
ChEMBLiCHEMBL2176769
DrugBankiDB04188, MDL72527
DB00127, Spermine

PTM databases

iPTMnetiQ9NWM0
PhosphoSitePlusiQ9NWM0

Genetic variation databases

BioMutaiSMOX
DMDMi50401688

Proteomic databases

jPOSTiQ9NWM0
MassIVEiQ9NWM0
MaxQBiQ9NWM0
PaxDbiQ9NWM0
PeptideAtlasiQ9NWM0
PRIDEiQ9NWM0
ProteomicsDBi82946 [Q9NWM0-1]
82947 [Q9NWM0-2]
82948 [Q9NWM0-3]
82949 [Q9NWM0-4]
82950 [Q9NWM0-5]
82951 [Q9NWM0-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23782, 128 antibodies

The DNASU plasmid repository

More...
DNASUi
54498

Genome annotation databases

EnsembliENST00000278795; ENSP00000278795; ENSG00000088826 [Q9NWM0-4]
ENST00000305958; ENSP00000307252; ENSG00000088826 [Q9NWM0-1]
ENST00000339123; ENSP00000344595; ENSG00000088826 [Q9NWM0-2]
ENST00000346595; ENSP00000341775; ENSG00000088826 [Q9NWM0-3]
ENST00000379460; ENSP00000368773; ENSG00000088826 [Q9NWM0-1]
ENST00000621355; ENSP00000478305; ENSG00000088826 [Q9NWM0-6]
GeneIDi54498
KEGGihsa:54498
UCSCiuc002wkk.2, human [Q9NWM0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54498
DisGeNETi54498

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SMOX
HGNCiHGNC:15862, SMOX
HPAiENSG00000088826, Low tissue specificity
MIMi615854, gene
neXtProtiNX_Q9NWM0
OpenTargetsiENSG00000088826
PharmGKBiPA25701
VEuPathDBiHostDB:ENSG00000088826

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0685, Eukaryota
GeneTreeiENSGT00940000157511
HOGENOMiCLU_004498_2_3_1
InParanoidiQ9NWM0
OMAiFWSSECN
OrthoDBi508351at2759
PhylomeDBiQ9NWM0
TreeFamiTF318348

Enzyme and pathway databases

UniPathwayiUPA00211
BioCyciMetaCyc:HS01609-MONOMER
BRENDAi1.5.3.16, 2681
PathwayCommonsiQ9NWM0
ReactomeiR-HSA-141334, PAOs oxidise polyamines to amines [Q9NWM0-3]
R-HSA-351200, Interconversion of polyamines [Q9NWM0-3]
SABIO-RKiQ9NWM0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
54498, 5 hits in 1022 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SMOX, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SMOX

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54498
PharosiQ9NWM0, Tbio

Protein Ontology

More...
PROi
PR:Q9NWM0
RNActiQ9NWM0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000088826, Expressed in nucleus accumbens and 220 other tissues
ExpressionAtlasiQ9NWM0, baseline and differential
GenevisibleiQ9NWM0, HS

Family and domain databases

Gene3Di3.50.50.60, 2 hits
InterProiView protein in InterPro
IPR002937, Amino_oxidase
IPR036188, FAD/NAD-bd_sf
PfamiView protein in Pfam
PF01593, Amino_oxidase, 2 hits
SUPFAMiSSF51905, SSF51905, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSMOX_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NWM0
Secondary accession number(s): A2A2P5
, A2A2P6, A8BE87, D3DVZ4, Q5TE26, Q5TE27, Q6UY28, Q8IX00, Q96LC3, Q96LC4, Q96QT3, Q9BW38, Q9H6H1, Q9NP51, Q9NPY1, Q9NPY2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: October 1, 2000
Last modified: September 29, 2021
This is version 165 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again