Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BSD domain-containing protein 1

Gene

BSDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
BSD domain-containing protein 1
Gene namesi
Name:BSDC1
ORF Names:UNQ2494/PRO5781
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000160058.18
HGNCiHGNC:25501 BSDC1
MIMi617518 gene
neXtProtiNX_Q9NW68

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000160058
PharmGKBiPA142672548

Polymorphism and mutation databases

BioMutaiBSDC1
DMDMi74753009

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002826391 – 430BSD domain-containing protein 1Add BLAST430

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei92PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei356PhosphothreonineCombined sources1
Modified residuei387PhosphoserineCombined sources1
Modified residuei388PhosphoserineCombined sources1
Modified residuei418PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NW68
MaxQBiQ9NW68
PaxDbiQ9NW68
PeptideAtlasiQ9NW68
PRIDEiQ9NW68
ProteomicsDBi82899
82900 [Q9NW68-2]
82901 [Q9NW68-3]
82902 [Q9NW68-4]
82903 [Q9NW68-5]
82904 [Q9NW68-6]
82905 [Q9NW68-7]
82906 [Q9NW68-8]
82907 [Q9NW68-9]

PTM databases

iPTMnetiQ9NW68
PhosphoSitePlusiQ9NW68

Expressioni

Gene expression databases

BgeeiENSG00000160058 Expressed in 232 organ(s), highest expression level in adrenal tissue
CleanExiHS_BSDC1
ExpressionAtlasiQ9NW68 baseline and differential
GenevisibleiQ9NW68 HS

Organism-specific databases

HPAiHPA031358
HPA031360

Interactioni

Protein-protein interaction databases

BioGridi120418, 5 interactors
IntActiQ9NW68, 9 interactors
MINTiQ9NW68

Structurei

3D structure databases

ProteinModelPortaliQ9NW68
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini146 – 198BSDPROSITE-ProRule annotationAdd BLAST53

Phylogenomic databases

eggNOGiKOG2690 Eukaryota
ENOG4110FD4 LUCA
GeneTreeiENSGT00390000009361
HOVERGENiHBG106482
InParanoidiQ9NW68
OMAiPQSPCEE
OrthoDBiEOG091G0HH6
PhylomeDBiQ9NW68
TreeFamiTF313210

Family and domain databases

Gene3Di1.10.3970.10, 1 hit
InterProiView protein in InterPro
IPR005607 BSD_dom
IPR035925 BSD_dom_sf
PfamiView protein in Pfam
PF03909 BSD, 1 hit
SMARTiView protein in SMART
SM00751 BSD, 1 hit
PROSITEiView protein in PROSITE
PS50858 BSD, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 4 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9NW68-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEGEDVGWW RSWLQQSYQA VKEKSSEALE FMKRDLTEFT QVVQHDTACT
60 70 80 90 100
IAATASVVKE KLATEGSSGA TEKMKKGLSD FLGVISDTFA PSPDKTIDCD
110 120 130 140 150
VITLMGTPSG TAEPYDGTKA RLYSLQSDPA TYCNEPDGPP ELFDAWLSQF
160 170 180 190 200
CLEEKKGEIS ELLVGSPSIR ALYTKMVPAA VSHSEFWHRY FYKVHQLEQE
210 220 230 240 250
QARRDALKQR AEQSISEEPG WEEEEEELMG ISPISPKEAK VPVAKISTFP
260 270 280 290 300
EGEPGPQSPC EENLVTSVEP PAEVTPSESS ESISLVTQIA NPATAPEARV
310 320 330 340 350
LPKDLSQKLL EASLEEQGLA VDVGETGPSP PIHSKPLTPA GHTGGPEPRP
360 370 380 390 400
PARVETLREE APTDLRVFEL NSDSGKSTPS NNGKKGSSTD ISEDWEKDFD
410 420 430
LDMTEEEVQM ALSKVDASGE LEDVEWEDWE
Length:430
Mass (Da):47,163
Last modified:October 1, 2000 - v1
Checksum:i4031A3DC18A33646
GO
Isoform 2 (identifier: Q9NW68-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-386: G → ETRSQFTVDFLWKISVTLLEPLGQSASPLFSNLPFPRLKHGHQ
     387-430: Missing.

Show »
Length:428
Mass (Da):46,860
Checksum:iCAF6314F34758FBC
GO
Isoform 3 (identifier: Q9NW68-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Show »
Length:474
Mass (Da):51,167
Checksum:iAE097F0DE5C2D6E4
GO
Isoform 4 (identifier: Q9NW68-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Show »
Length:353
Mass (Da):37,994
Checksum:i8E2AE07789DDEE97
GO
Isoform 5 (identifier: Q9NW68-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-173: WLSQFCLEEKKGEISELLVGSPSIRALY → CQPELWAQILVAPCWPSWASAHTWEGAL
     174-430: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):18,901
Checksum:i56B1ADA0DEBEFC6F
GO
Isoform 6 (identifier: Q9NW68-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.
     360-385: EAPTDLRVFELNSDSGKSTPSNNGKK → MLSPQLHPLQVPLPCLLLLFTLWLVVP
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Note: No experimental confirmation available.
Show »
Length:99
Mass (Da):10,525
Checksum:i7676A2A4241391BC
GO
Isoform 7 (identifier: Q9NW68-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ

Show »
Length:447
Mass (Da):48,932
Checksum:iA18E2B7A4B640F92
GO
Isoform 8 (identifier: Q9NW68-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-120: TEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKA → A

Show »
Length:374
Mass (Da):41,412
Checksum:iB3126EBBE72FC029
GO
Isoform 9 (identifier: Q9NW68-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-119: Missing.

Show »
Length:335
Mass (Da):37,160
Checksum:iB95AAECFDBBF6B00
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQA7E9PQA7_HUMAN
BSD domain-containing protein 1
BSDC1
177Annotation score:
E9PS77E9PS77_HUMAN
BSD domain-containing protein 1
BSDC1
156Annotation score:
E9PNA9E9PNA9_HUMAN
BSD domain-containing protein 1
BSDC1
89Annotation score:
F8W6C6F8W6C6_HUMAN
BSD domain-containing protein 1
BSDC1
64Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti128D → G in CAH18084 (PubMed:17974005).Curated1
Sequence conflicti137D → G in AAH26322 (PubMed:15489334).Curated1
Sequence conflicti143F → L in BAB13825 (PubMed:14702039).Curated1
Sequence conflicti149Q → K in AAH26322 (PubMed:15489334).Curated1
Sequence conflicti250P → H in AAH26322 (PubMed:15489334).Curated1
Sequence conflicti287T → A in AAH26322 (PubMed:15489334).Curated1
Sequence conflicti430E → D in CAG33533 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0242161 – 359Missing in isoform 6. 1 PublicationAdd BLAST359
Alternative sequenceiVSP_0242171 – 104Missing in isoform 4. 2 PublicationsAdd BLAST104
Alternative sequenceiVSP_04167225 – 119Missing in isoform 9. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_02421863A → AIAACSRGACFLCPFSIQ in isoform 3 and isoform 7. 2 Publications1
Alternative sequenceiVSP_04167364 – 120TEGSS…DGTKA → A in isoform 8. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_024219146 – 173WLSQF…IRALY → CQPELWAQILVAPCWPSWAS AHTWEGAL in isoform 5. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_024220174 – 430Missing in isoform 5. 1 PublicationAdd BLAST257
Alternative sequenceiVSP_024221360 – 385EAPTD…NNGKK → MLSPQLHPLQVPLPCLLLLF TLWLVVP in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_024222386G → ETRSQFTVDFLWKISVTLLE PLGQSASPLFSNLPFPRLKH GHQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_024223387 – 430Missing in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_024224421 – 430LEDVEWEDWE → VSGPGGSEGSEPNGPGCESS PQPAQLSPQEGPCSCLR in isoform 3, isoform 4 and isoform 6. 3 Publications10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358230 mRNA Translation: AAQ88597.1
AK001138 mRNA Translation: BAA91517.1
AK021440 mRNA Translation: BAB13825.1
AK297604 mRNA Translation: BAG59989.1
AK300231 mRNA Translation: BAG61999.1
AK300306 mRNA Translation: BAG62059.1
AK304477 mRNA Translation: BAG65290.1
CR457252 mRNA Translation: CAG33533.1
BX641056 mRNA Translation: CAE46029.1
CR749228 mRNA Translation: CAH18084.1
AL109945 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07526.1
BC026322 mRNA Translation: AAH26322.1
BC028381 mRNA Translation: AAH28381.1
CCDSiCCDS363.2 [Q9NW68-1]
CCDS44101.1 [Q9NW68-9]
CCDS44102.1 [Q9NW68-8]
CCDS44103.1 [Q9NW68-7]
CCDS72752.1 [Q9NW68-3]
RefSeqiNP_001137360.1, NM_001143888.2 [Q9NW68-7]
NP_001137361.1, NM_001143889.2 [Q9NW68-8]
NP_001137362.1, NM_001143890.2 [Q9NW68-9]
NP_001287887.1, NM_001300958.1 [Q9NW68-3]
NP_060515.3, NM_018045.7 [Q9NW68-1]
UniGeneiHs.353454

Genome annotation databases

EnsembliENST00000341071; ENSP00000344816; ENSG00000160058 [Q9NW68-3]
ENST00000419121; ENSP00000405752; ENSG00000160058 [Q9NW68-8]
ENST00000444377; ENSP00000414103; ENSG00000160058 [Q9NW68-2]
ENST00000446293; ENSP00000397759; ENSG00000160058 [Q9NW68-7]
ENST00000455895; ENSP00000412173; ENSG00000160058 [Q9NW68-1]
ENST00000526031; ENSP00000432382; ENSG00000160058 [Q9NW68-9]
GeneIDi55108
KEGGihsa:55108
UCSCiuc001bvh.5 human [Q9NW68-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBSDC1_HUMAN
AccessioniPrimary (citable) accession number: Q9NW68
Secondary accession number(s): B4DMS7
, B4DTI7, B4DTP7, B4E2X8, Q49AT8, Q68DY6, Q6IAA3, Q6MZK1, Q6UXS1, Q9HAL9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2000
Last modified: September 12, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again