Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein S18a, mitochondrial

Gene

MRPS18A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Miscellaneous

There are 3 mitochondrial isoforms of bS18 in mammalia, localizing to 3 distinct sites in the mitoribosome. bS18m (bs18c) binds to the same site as bacterial bS18, mS40 (bS18b) binds to a novel location of the 28S small subunit, and mL66 (bS18a, this protein) binds to the 39S large subunit.1 Publication

GO - Molecular functioni

  • small ribosomal subunit rRNA binding Source: GO_Central
  • structural constituent of ribosome Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein S18a, mitochondrial
Short name:
MRP-S18-a
Short name:
Mrps18a
Short name:
S18mt-a
Alternative name(s):
39S ribosomal protein S18-3, mitochondrial
Short name:
MRP-S18-3
Mitochondrial large ribosomal subunit protein bS18a1 Publication
Mitochondrial large ribosomal subunit protein mL661 Publication
Gene namesi
Name:MRPS18A
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000096080.11
HGNCiHGNC:14515 MRPS18A
MIMi611981 gene
neXtProtiNX_Q9NVS2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000096080
PharmGKBiPA31003

Polymorphism and mutation databases

BioMutaiMRPS18A
DMDMi24212201

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 34MitochondrionBy similarityAdd BLAST34
ChainiPRO_000003062535 – 19639S ribosomal protein S18a, mitochondrialAdd BLAST162

Proteomic databases

EPDiQ9NVS2
MaxQBiQ9NVS2
PaxDbiQ9NVS2
PeptideAtlasiQ9NVS2
PRIDEiQ9NVS2
ProteomicsDBi82852
82853 [Q9NVS2-2]
82854 [Q9NVS2-3]
TopDownProteomicsiQ9NVS2-1 [Q9NVS2-1]
Q9NVS2-2 [Q9NVS2-2]

PTM databases

PhosphoSitePlusiQ9NVS2
SwissPalmiQ9NVS2

Expressioni

Gene expression databases

BgeeiENSG00000096080 Expressed in 219 organ(s), highest expression level in gastrocnemius
CleanExiHS_MRPS18A
ExpressionAtlasiQ9NVS2 baseline and differential
GenevisibleiQ9NVS2 HS

Organism-specific databases

HPAiHPA035450
HPA035451

Interactioni

Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:28892042, PubMed:25838379, PubMed:25278503). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins. mL66 forms a zinc-binding site with uL10m.3 Publications

Protein-protein interaction databases

BioGridi120468, 40 interactors
CORUMiQ9NVS2
IntActiQ9NVS2, 12 interactors
MINTiQ9NVS2
STRINGi9606.ENSP00000361206

Structurei

Secondary structure

1196
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NVS2
SMRiQ9NVS2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3162 Eukaryota
COG0238 LUCA
GeneTreeiENSGT00390000006493
HOGENOMiHOG000139370
HOVERGENiHBG058800
InParanoidiQ9NVS2
KOiK02963
PhylomeDBiQ9NVS2
TreeFamiTF315738

Family and domain databases

Gene3Di4.10.640.10, 1 hit
InterProiView protein in InterPro
IPR001648 Ribosomal_S18
IPR036870 Ribosomal_S18_sf
PfamiView protein in Pfam
PF01084 Ribosomal_S18, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002239 Ribosomal_S18, 1 hit
SUPFAMiSSF46911 SSF46911, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NVS2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE
60 70 80 90 100
GRITATPKES PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML
110 120 130 140 150
PRKITGLCQE EHRKIEECVK MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY
160 170 180 190
LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL LRDNVCYSRT PWKLYH
Length:196
Mass (Da):22,184
Last modified:October 1, 2000 - v1
Checksum:iCC086B8FC27242D6
GO
Isoform 2 (identifier: Q9NVS2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: A → AGRRPWGPRG...QRLSPLPRHS

Show »
Length:270
Mass (Da):30,540
Checksum:i2EEB47D86FC277F0
GO
Isoform 3 (identifier: Q9NVS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):14,030
Checksum:iC5BA5F97CADB7D87
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5QPA5Q5QPA5_HUMAN
39S ribosomal protein S18a, mitocho...
MRPS18A
263Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041245125A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. 1 Publication1
Alternative sequenceiVSP_043496127 – 196LLPNH…WKLYH → T in isoform 3. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB049952 mRNA Translation: BAB41005.1
DQ884400 mRNA Translation: ABI63367.1
AK001410 mRNA Translation: BAA91675.1
AK300757 mRNA Translation: BAG62423.1
AL136131 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04225.1
BC010364 mRNA Translation: AAH10364.1
CCDSiCCDS4906.1 [Q9NVS2-1]
CCDS55006.1 [Q9NVS2-3]
RefSeqiNP_001180272.1, NM_001193343.1 [Q9NVS2-3]
NP_060605.1, NM_018135.3 [Q9NVS2-1]
XP_006715197.1, XM_006715134.2 [Q9NVS2-2]
UniGeneiHs.520149

Genome annotation databases

EnsembliENST00000372116; ENSP00000361188; ENSG00000096080 [Q9NVS2-3]
ENST00000372133; ENSP00000361206; ENSG00000096080 [Q9NVS2-1]
GeneIDi55168
KEGGihsa:55168
UCSCiuc003ovy.3 human [Q9NVS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB049952 mRNA Translation: BAB41005.1
DQ884400 mRNA Translation: ABI63367.1
AK001410 mRNA Translation: BAA91675.1
AK300757 mRNA Translation: BAG62423.1
AL136131 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04225.1
BC010364 mRNA Translation: AAH10364.1
CCDSiCCDS4906.1 [Q9NVS2-1]
CCDS55006.1 [Q9NVS2-3]
RefSeqiNP_001180272.1, NM_001193343.1 [Q9NVS2-3]
NP_060605.1, NM_018135.3 [Q9NVS2-1]
XP_006715197.1, XM_006715134.2 [Q9NVS2-2]
UniGeneiHs.520149

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40r1-196[»]
3J9Melectron microscopy3.50r1-196[»]
5OOLelectron microscopy3.06r1-196[»]
5OOMelectron microscopy3.03r1-196[»]
ProteinModelPortaliQ9NVS2
SMRiQ9NVS2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120468, 40 interactors
CORUMiQ9NVS2
IntActiQ9NVS2, 12 interactors
MINTiQ9NVS2
STRINGi9606.ENSP00000361206

PTM databases

PhosphoSitePlusiQ9NVS2
SwissPalmiQ9NVS2

Polymorphism and mutation databases

BioMutaiMRPS18A
DMDMi24212201

Proteomic databases

EPDiQ9NVS2
MaxQBiQ9NVS2
PaxDbiQ9NVS2
PeptideAtlasiQ9NVS2
PRIDEiQ9NVS2
ProteomicsDBi82852
82853 [Q9NVS2-2]
82854 [Q9NVS2-3]
TopDownProteomicsiQ9NVS2-1 [Q9NVS2-1]
Q9NVS2-2 [Q9NVS2-2]

Protocols and materials databases

DNASUi55168
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372116; ENSP00000361188; ENSG00000096080 [Q9NVS2-3]
ENST00000372133; ENSP00000361206; ENSG00000096080 [Q9NVS2-1]
GeneIDi55168
KEGGihsa:55168
UCSCiuc003ovy.3 human [Q9NVS2-1]

Organism-specific databases

CTDi55168
EuPathDBiHostDB:ENSG00000096080.11
GeneCardsiMRPS18A
HGNCiHGNC:14515 MRPS18A
HPAiHPA035450
HPA035451
MIMi611981 gene
neXtProtiNX_Q9NVS2
OpenTargetsiENSG00000096080
PharmGKBiPA31003
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3162 Eukaryota
COG0238 LUCA
GeneTreeiENSGT00390000006493
HOGENOMiHOG000139370
HOVERGENiHBG058800
InParanoidiQ9NVS2
KOiK02963
PhylomeDBiQ9NVS2
TreeFamiTF315738

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Miscellaneous databases

GeneWikiiMRPS18A
GenomeRNAii55168
PROiPR:Q9NVS2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000096080 Expressed in 219 organ(s), highest expression level in gastrocnemius
CleanExiHS_MRPS18A
ExpressionAtlasiQ9NVS2 baseline and differential
GenevisibleiQ9NVS2 HS

Family and domain databases

Gene3Di4.10.640.10, 1 hit
InterProiView protein in InterPro
IPR001648 Ribosomal_S18
IPR036870 Ribosomal_S18_sf
PfamiView protein in Pfam
PF01084 Ribosomal_S18, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002239 Ribosomal_S18, 1 hit
SUPFAMiSSF46911 SSF46911, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRT18A_HUMAN
AccessioniPrimary (citable) accession number: Q9NVS2
Secondary accession number(s): A6XND3, Q5QPA4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Ribosomal proteins
    Ribosomal proteins families and list of entries
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again