Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fas apoptotic inhibitory molecule 1

Gene

FAIM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.By similarity

GO - Biological processi

Keywordsi

Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Fas apoptotic inhibitory molecule 1
Gene namesi
Name:FAIM
Synonyms:FAIM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000158234.12
HGNCiHGNC:18703 FAIM
MIMi617535 gene
neXtProtiNX_Q9NVQ4

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi55179
OpenTargetsiENSG00000158234
PharmGKBiPA38647

Polymorphism and mutation databases

BioMutaiFAIM
DMDMi38503210

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000871732 – 179Fas apoptotic inhibitory molecule 1Add BLAST178

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NVQ4
MaxQBiQ9NVQ4
PaxDbiQ9NVQ4
PeptideAtlasiQ9NVQ4
PRIDEiQ9NVQ4
ProteomicsDBi82844
82845 [Q9NVQ4-2]
82846 [Q9NVQ4-3]

PTM databases

iPTMnetiQ9NVQ4
PhosphoSitePlusiQ9NVQ4

Expressioni

Gene expression databases

BgeeiENSG00000158234 Expressed in 225 organ(s), highest expression level in bronchial epithelial cell
CleanExiHS_FAIM
ExpressionAtlasiQ9NVQ4 baseline and differential
GenevisibleiQ9NVQ4 HS

Organism-specific databases

HPAiHPA042440
HPA052209

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi120478, 10 interactors
IntActiQ9NVQ4, 9 interactors
STRINGi9606.ENSP00000342805

Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NVQ4
SMRiQ9NVQ4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAIM1 family.Curated

Phylogenomic databases

eggNOGiKOG4352 Eukaryota
ENOG410XRNP LUCA
GeneTreeiENSGT00390000007364
HOGENOMiHOG000007913
HOVERGENiHBG051543
InParanoidiQ9NVQ4
OMAiSVGNHDC
OrthoDBiEOG091G0MZK
PhylomeDBiQ9NVQ4
TreeFamiTF314971

Family and domain databases

Gene3Di2.40.128.180, 2 hits
InterProiView protein in InterPro
IPR010695 FAIM1
IPR038513 FAIM1_dom_sf
PANTHERiPTHR13088 PTHR13088, 1 hit
PfamiView protein in Pfam
PF06905 FAIM1, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to basket
Also known as: FAIM-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG
60 70 80 90 100
KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW
110 120 130 140 150
VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY
160 170
IKAVSSGKRK EGIIHTLIVD NREIPEIAS
Length:179
Mass (Da):20,215
Last modified:October 1, 2000 - v1
Checksum:i129E7E4525535C72
GO
Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

Show »
Length:213
Mass (Da):24,041
Checksum:iF4350AA22E14A727
GO
Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to basket
Also known as: FAIM-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Show »
Length:201
Mass (Da):22,626
Checksum:i785BB238F63F4568
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JDZ2C9JDZ2_HUMAN
Fas apoptotic inhibitory molecule 1
FAIM
128Annotation score:

Sequence cautioni

The sequence BAC86174 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti32V → L in BQ638715 (PubMed:12107411).Curated1
Sequence conflicti66N → S in CAG33403 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024314117A → T2 PublicationsCorresponds to variant dbSNP:rs641320Ensembl.1
Natural variantiVAR_024315127L → S1 PublicationCorresponds to variant dbSNP:rs13043Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0089911M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0380951M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA Translation: BAA91695.1
AK125477 mRNA Translation: BAC86174.1 Sequence problems.
CR457122 mRNA Translation: CAG33403.1
AC020890 Genomic DNA No translation available.
BC012478 mRNA Translation: AAH12478.1
BQ638715 mRNA No translation available.
CCDSiCCDS3103.1 [Q9NVQ4-1]
CCDS33864.1 [Q9NVQ4-2]
CCDS33865.1 [Q9NVQ4-3]
RefSeqiNP_001028202.1, NM_001033030.1 [Q9NVQ4-2]
NP_001028203.1, NM_001033031.1 [Q9NVQ4-3]
NP_001028204.1, NM_001033032.1 [Q9NVQ4-1]
NP_060617.1, NM_018147.3 [Q9NVQ4-1]
UniGeneiHs.173438

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234 [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234 [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234 [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234 [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234 [Q9NVQ4-1]
GeneIDi55179
KEGGihsa:55179
UCSCiuc003esp.4 human [Q9NVQ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA Translation: BAA91695.1
AK125477 mRNA Translation: BAC86174.1 Sequence problems.
CR457122 mRNA Translation: CAG33403.1
AC020890 Genomic DNA No translation available.
BC012478 mRNA Translation: AAH12478.1
BQ638715 mRNA No translation available.
CCDSiCCDS3103.1 [Q9NVQ4-1]
CCDS33864.1 [Q9NVQ4-2]
CCDS33865.1 [Q9NVQ4-3]
RefSeqiNP_001028202.1, NM_001033030.1 [Q9NVQ4-2]
NP_001028203.1, NM_001033031.1 [Q9NVQ4-3]
NP_001028204.1, NM_001033032.1 [Q9NVQ4-1]
NP_060617.1, NM_018147.3 [Q9NVQ4-1]
UniGeneiHs.173438

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4
SMRiQ9NVQ4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120478, 10 interactors
IntActiQ9NVQ4, 9 interactors
STRINGi9606.ENSP00000342805

PTM databases

iPTMnetiQ9NVQ4
PhosphoSitePlusiQ9NVQ4

Polymorphism and mutation databases

BioMutaiFAIM
DMDMi38503210

Proteomic databases

EPDiQ9NVQ4
MaxQBiQ9NVQ4
PaxDbiQ9NVQ4
PeptideAtlasiQ9NVQ4
PRIDEiQ9NVQ4
ProteomicsDBi82844
82845 [Q9NVQ4-2]
82846 [Q9NVQ4-3]

Protocols and materials databases

DNASUi55179
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234 [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234 [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234 [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234 [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234 [Q9NVQ4-1]
GeneIDi55179
KEGGihsa:55179
UCSCiuc003esp.4 human [Q9NVQ4-1]

Organism-specific databases

CTDi55179
DisGeNETi55179
EuPathDBiHostDB:ENSG00000158234.12
GeneCardsiFAIM
HGNCiHGNC:18703 FAIM
HPAiHPA042440
HPA052209
MIMi617535 gene
neXtProtiNX_Q9NVQ4
OpenTargetsiENSG00000158234
PharmGKBiPA38647
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4352 Eukaryota
ENOG410XRNP LUCA
GeneTreeiENSGT00390000007364
HOGENOMiHOG000007913
HOVERGENiHBG051543
InParanoidiQ9NVQ4
OMAiSVGNHDC
OrthoDBiEOG091G0MZK
PhylomeDBiQ9NVQ4
TreeFamiTF314971

Miscellaneous databases

ChiTaRSiFAIM human
GenomeRNAii55179
PROiPR:Q9NVQ4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000158234 Expressed in 225 organ(s), highest expression level in bronchial epithelial cell
CleanExiHS_FAIM
ExpressionAtlasiQ9NVQ4 baseline and differential
GenevisibleiQ9NVQ4 HS

Family and domain databases

Gene3Di2.40.128.180, 2 hits
InterProiView protein in InterPro
IPR010695 FAIM1
IPR038513 FAIM1_dom_sf
PANTHERiPTHR13088 PTHR13088, 1 hit
PfamiView protein in Pfam
PF06905 FAIM1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFAIM1_HUMAN
AccessioniPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 21, 2003
Last sequence update: October 1, 2000
Last modified: September 12, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again