Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fas apoptotic inhibitory molecule 1

Gene

FAIM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fas apoptotic inhibitory molecule 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAIM
Synonyms:FAIM1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000158234.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18703 FAIM

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617535 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NVQ4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55179

Open Targets

More...
OpenTargetsi
ENSG00000158234

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38647

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAIM

Domain mapping of disease mutations (DMDM)

More...
DMDMi
38503210

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000871732 – 179Fas apoptotic inhibitory molecule 1Add BLAST178

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NVQ4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NVQ4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NVQ4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NVQ4

PeptideAtlas

More...
PeptideAtlasi
Q9NVQ4

PRoteomics IDEntifications database

More...
PRIDEi
Q9NVQ4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82844
82845 [Q9NVQ4-2]
82846 [Q9NVQ4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NVQ4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NVQ4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158234 Expressed in 225 organ(s), highest expression level in bronchial epithelial cell

CleanEx database of gene expression profiles

More...
CleanExi
HS_FAIM

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NVQ4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NVQ4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042440
HPA052209

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120478, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NVQ4, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342805

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9NVQ4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NVQ4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAIM1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4352 Eukaryota
ENOG410XRNP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007364

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007913

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051543

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NVQ4

Identification of Orthologs from Complete Genome Data

More...
OMAi
ETKATIN

Database of Orthologous Groups

More...
OrthoDBi
1301275at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NVQ4

TreeFam database of animal gene trees

More...
TreeFami
TF314971

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.128.180, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010695 FAIM1
IPR038513 FAIM1_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13088 PTHR13088, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06905 FAIM1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to basket
Also known as: FAIM-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG
60 70 80 90 100
KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW
110 120 130 140 150
VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY
160 170
IKAVSSGKRK EGIIHTLIVD NREIPEIAS
Length:179
Mass (Da):20,215
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i129E7E4525535C72
GO
Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

Show »
Length:213
Mass (Da):24,041
Checksum:iF4350AA22E14A727
GO
Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to basket
Also known as: FAIM-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Show »
Length:201
Mass (Da):22,626
Checksum:i785BB238F63F4568
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JDZ2C9JDZ2_HUMAN
Fas apoptotic inhibitory molecule 1
FAIM
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC86174 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32V → L in BQ638715 (PubMed:12107411).Curated1
Sequence conflicti66N → S in CAG33403 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024314117A → T2 PublicationsCorresponds to variant dbSNP:rs641320Ensembl.1
Natural variantiVAR_024315127L → S1 PublicationCorresponds to variant dbSNP:rs13043Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0089911M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0380951M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001444 mRNA Translation: BAA91695.1
AK125477 mRNA Translation: BAC86174.1 Sequence problems.
CR457122 mRNA Translation: CAG33403.1
AC020890 Genomic DNA No translation available.
BC012478 mRNA Translation: AAH12478.1
BQ638715 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3103.1 [Q9NVQ4-1]
CCDS33864.1 [Q9NVQ4-2]
CCDS33865.1 [Q9NVQ4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001028202.1, NM_001033030.1 [Q9NVQ4-2]
NP_001028203.1, NM_001033031.1 [Q9NVQ4-3]
NP_001028204.1, NM_001033032.1 [Q9NVQ4-1]
NP_060617.1, NM_018147.3 [Q9NVQ4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.173438

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338446; ENSP00000342805; ENSG00000158234 [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234 [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234 [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234 [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234 [Q9NVQ4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55179

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55179

UCSC genome browser

More...
UCSCi
uc003esp.4 human [Q9NVQ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA Translation: BAA91695.1
AK125477 mRNA Translation: BAC86174.1 Sequence problems.
CR457122 mRNA Translation: CAG33403.1
AC020890 Genomic DNA No translation available.
BC012478 mRNA Translation: AAH12478.1
BQ638715 mRNA No translation available.
CCDSiCCDS3103.1 [Q9NVQ4-1]
CCDS33864.1 [Q9NVQ4-2]
CCDS33865.1 [Q9NVQ4-3]
RefSeqiNP_001028202.1, NM_001033030.1 [Q9NVQ4-2]
NP_001028203.1, NM_001033031.1 [Q9NVQ4-3]
NP_001028204.1, NM_001033032.1 [Q9NVQ4-1]
NP_060617.1, NM_018147.3 [Q9NVQ4-1]
UniGeneiHs.173438

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4
SMRiQ9NVQ4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120478, 10 interactors
IntActiQ9NVQ4, 9 interactors
STRINGi9606.ENSP00000342805

PTM databases

iPTMnetiQ9NVQ4
PhosphoSitePlusiQ9NVQ4

Polymorphism and mutation databases

BioMutaiFAIM
DMDMi38503210

Proteomic databases

EPDiQ9NVQ4
jPOSTiQ9NVQ4
MaxQBiQ9NVQ4
PaxDbiQ9NVQ4
PeptideAtlasiQ9NVQ4
PRIDEiQ9NVQ4
ProteomicsDBi82844
82845 [Q9NVQ4-2]
82846 [Q9NVQ4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55179
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234 [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234 [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234 [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234 [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234 [Q9NVQ4-1]
GeneIDi55179
KEGGihsa:55179
UCSCiuc003esp.4 human [Q9NVQ4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55179
DisGeNETi55179
EuPathDBiHostDB:ENSG00000158234.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAIM
HGNCiHGNC:18703 FAIM
HPAiHPA042440
HPA052209
MIMi617535 gene
neXtProtiNX_Q9NVQ4
OpenTargetsiENSG00000158234
PharmGKBiPA38647

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4352 Eukaryota
ENOG410XRNP LUCA
GeneTreeiENSGT00390000007364
HOGENOMiHOG000007913
HOVERGENiHBG051543
InParanoidiQ9NVQ4
OMAiETKATIN
OrthoDBi1301275at2759
PhylomeDBiQ9NVQ4
TreeFamiTF314971

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAIM human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55179

Protein Ontology

More...
PROi
PR:Q9NVQ4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158234 Expressed in 225 organ(s), highest expression level in bronchial epithelial cell
CleanExiHS_FAIM
ExpressionAtlasiQ9NVQ4 baseline and differential
GenevisibleiQ9NVQ4 HS

Family and domain databases

Gene3Di2.40.128.180, 2 hits
InterProiView protein in InterPro
IPR010695 FAIM1
IPR038513 FAIM1_dom_sf
PANTHERiPTHR13088 PTHR13088, 1 hit
PfamiView protein in Pfam
PF06905 FAIM1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAIM1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 21, 2003
Last sequence update: October 1, 2000
Last modified: January 16, 2019
This is version 130 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again