Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (02 Jun 2021)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

SPATS2-like protein

Gene

SPATS2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NUQ6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SPATS2-like protein
Alternative name(s):
DNA polymerase-transactivated protein 6
Stress granule and nucleolar protein
Short name:
SGNP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPATS2L
Synonyms:DNAPTP6
ORF Names:SP1224
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24574, SPATS2L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613817, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NUQ6

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000196141.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26010

Open Targets

More...
OpenTargetsi
ENSG00000196141

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165697465

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NUQ6, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPATS2L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160185484

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003076992 – 558SPATS2-like proteinAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei120PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NUQ6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NUQ6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NUQ6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NUQ6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NUQ6

PeptideAtlas

More...
PeptideAtlasi
Q9NUQ6

PRoteomics IDEntifications database

More...
PRIDEi
Q9NUQ6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5078
82709 [Q9NUQ6-1]
82710 [Q9NUQ6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NUQ6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NUQ6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196141, Expressed in epithelium of bronchus and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NUQ6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NUQ6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000196141, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
117483, 41 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NUQ6, 28 interactors

Molecular INTeraction database

More...
MINTi
Q9NUQ6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000482515

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NUQ6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NUQ6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni63 – 134DisorderedSequence analysisAdd BLAST72
Regioni157 – 201DisorderedSequence analysisAdd BLAST45
Regioni380 – 525DisorderedSequence analysisAdd BLAST146

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili271 – 344Sequence analysisAdd BLAST74

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi64 – 78Basic residuesSequence analysisAdd BLAST15
Compositional biasi103 – 123Polar residuesSequence analysisAdd BLAST21
Compositional biasi173 – 201Polar residuesSequence analysisAdd BLAST29
Compositional biasi380 – 399Polar residuesSequence analysisAdd BLAST20
Compositional biasi407 – 454Polar residuesSequence analysisAdd BLAST48
Compositional biasi502 – 518Basic and acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SPATS2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S51R, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001138

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_037089_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NUQ6

Identification of Orthologs from Complete Genome Data

More...
OMAi
CNLGRPK

Database of Orthologous Groups

More...
OrthoDBi
1523681at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NUQ6

TreeFam database of animal gene trees

More...
TreeFami
TF320553

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009816, DUF1387
IPR009060, UBA-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR15623, PTHR15623, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07139, DUF1387, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934, SSF46934, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NUQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELNTHVNV KEKIYAVRSV VPNKSNNEIV LVLQQFDFNV DKAVQAFVDG
60 70 80 90 100
SAIQVLKEWN MTGKKKNNKR KRSKSKQHQG NKDAKDKVER PEAGPLQPQP
110 120 130 140 150
PQIQNGPMNG CEKDSSSTDS ANEKPALIPR EKKISILEEP SKALRGVTEG
160 170 180 190 200
NRLLQQKLSL DGNPKPIHGT TERSDGLQWS AEQPCNPSKP KAKTSPVKSN
210 220 230 240 250
TPAAHLEIKP DELAKKRGPN IEKSVKDLQR CTVSLTRYRV MIKEEVDSSV
260 270 280 290 300
KKIKAAFAEL HNCIIDKEVS LMAEMDKVKE EAMEILTARQ KKAEELKRLT
310 320 330 340 350
DLASQMAEMQ LAELRAEIKH FVSERKYDEE LGKAARFSCD IEQLKAQIML
360 370 380 390 400
CGEITHPKNN YSSRTPCSSL LPLLNAHAAT SGKQSNFSRK SSTHNKPSEG
410 420 430 440 450
KAANPKMVSS LPSTADPSHQ TMPANKQNGS SNQRRRFNPQ YHNNRLNGPA
460 470 480 490 500
KSQGSGNEAE PLGKGNSRHE HRRQPHNGFR PKNKGGAKNQ EASLGMKTPE
510 520 530 540 550
APAHSEKPRR RQHAADTSEA RPFRGSVGRV SQCNLCPTRI EVSTDAAVLS

VPAVTLVA
Length:558
Mass (Da):61,729
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC2BB3431BA1E7B4C
GO
Isoform 2 (identifier: Q9NUQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-217: Missing.

Show »
Length:489
Mass (Da):54,178
Checksum:iE52B645A57817507
GO
Isoform 3 (identifier: Q9NUQ6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPFCHSSSETRLLSGTLLWIPRAYSTRSKM

Show »
Length:588
Mass (Da):65,152
Checksum:iF3FC15DE9749189B
GO
Isoform 4 (identifier: Q9NUQ6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYSTRSKM

Show »
Length:566
Mass (Da):62,654
Checksum:i2C0CCF0CFA9AEB09
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZZ7B8ZZZ7_HUMAN
DNA polymerase-transactivated prote...
SPATS2L DNAPTP6, hCG_1811464
498Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W6C2F8W6C2_HUMAN
SPATS2-like protein
SPATS2L
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JW67C9JW67_HUMAN
SPATS2-like protein
SPATS2L
238Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZC3C9IZC3_HUMAN
SPATS2-like protein
SPATS2L
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGM8C9JGM8_HUMAN
SPATS2-like protein
SPATS2L
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8M7C9J8M7_HUMAN
SPATS2-like protein
SPATS2L
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JKE4C9JKE4_HUMAN
SPATS2-like protein
SPATS2L
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2S1F2Z2S1_HUMAN
SPATS2-like protein
SPATS2L
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VT91F8VT91_HUMAN
SPATS2-like protein
SPATS2L
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZ02F8VZ02_HUMAN
SPATS2-like protein
SPATS2L
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG22487 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64Missing in AAH18736 (PubMed:15489334).Curated1
Sequence conflicti255A → T in BAA92065 (PubMed:14702039).Curated1
Sequence conflicti301D → N in AAR21087 (Ref. 1) Curated1
Sequence conflicti301D → N in CAB53658 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0542411M → MDPFCHSSSETRLLSGTLLW IPRAYSTRSKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0542421M → MAYSTRSKM in isoform 4. 1 Publication1
Alternative sequenceiVSP_028792149 – 217Missing in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY450394 mRNA Translation: AAR21087.1
AL110124 mRNA Translation: CAB53658.2
AK002064 mRNA Translation: BAA92065.1
AK290496 mRNA Translation: BAF83185.1
AK299223 mRNA Translation: BAG61258.1
AK300075 mRNA Translation: BAG61879.1
AF193059 mRNA Translation: AAG22487.1 Frameshift.
AC074213 Genomic DNA No translation available.
AC012459 Genomic DNA Translation: AAY24307.1
AC105381 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70197.1
BC018736 mRNA Translation: AAH18736.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46483.1 [Q9NUQ6-1]
CCDS46484.1 [Q9NUQ6-2]
CCDS74621.1 [Q9NUQ6-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T14738

NCBI Reference Sequences

More...
RefSeqi
NP_001093892.1, NM_001100422.1 [Q9NUQ6-1]
NP_001093893.1, NM_001100423.1 [Q9NUQ6-1]
NP_001093894.1, NM_001100424.1 [Q9NUQ6-2]
NP_001269664.1, NM_001282735.1 [Q9NUQ6-1]
NP_001269672.1, NM_001282743.1
NP_001269673.1, NM_001282744.1 [Q9NUQ6-3]
NP_056350.2, NM_015535.2 [Q9NUQ6-1]
XP_005246513.1, XM_005246456.1 [Q9NUQ6-1]
XP_005246514.1, XM_005246457.1 [Q9NUQ6-1]
XP_005246515.1, XM_005246458.1 [Q9NUQ6-1]
XP_005246516.1, XM_005246459.1 [Q9NUQ6-2]
XP_011509240.1, XM_011510938.1 [Q9NUQ6-3]
XP_011509241.1, XM_011510939.1 [Q9NUQ6-1]
XP_016859272.1, XM_017003783.1
XP_016859274.1, XM_017003785.1 [Q9NUQ6-2]
XP_016859275.1, XM_017003786.1 [Q9NUQ6-2]
XP_016859276.1, XM_017003787.1 [Q9NUQ6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358677; ENSP00000351503; ENSG00000196141 [Q9NUQ6-1]
ENST00000360760; ENSP00000353989; ENSG00000196141 [Q9NUQ6-2]
ENST00000409140; ENSP00000386730; ENSG00000196141 [Q9NUQ6-1]
ENST00000409151; ENSP00000386310; ENSG00000196141 [Q9NUQ6-4]
ENST00000409718; ENSP00000386336; ENSG00000196141 [Q9NUQ6-1]
ENST00000409988; ENSP00000386931; ENSG00000196141 [Q9NUQ6-1]
ENST00000451764; ENSP00000391467; ENSG00000196141 [Q9NUQ6-1]
ENST00000619961; ENSP00000482515; ENSG00000196141 [Q9NUQ6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26010

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26010

UCSC genome browser

More...
UCSCi
uc002uvn.5, human [Q9NUQ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY450394 mRNA Translation: AAR21087.1
AL110124 mRNA Translation: CAB53658.2
AK002064 mRNA Translation: BAA92065.1
AK290496 mRNA Translation: BAF83185.1
AK299223 mRNA Translation: BAG61258.1
AK300075 mRNA Translation: BAG61879.1
AF193059 mRNA Translation: AAG22487.1 Frameshift.
AC074213 Genomic DNA No translation available.
AC012459 Genomic DNA Translation: AAY24307.1
AC105381 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70197.1
BC018736 mRNA Translation: AAH18736.1
CCDSiCCDS46483.1 [Q9NUQ6-1]
CCDS46484.1 [Q9NUQ6-2]
CCDS74621.1 [Q9NUQ6-3]
PIRiT14738
RefSeqiNP_001093892.1, NM_001100422.1 [Q9NUQ6-1]
NP_001093893.1, NM_001100423.1 [Q9NUQ6-1]
NP_001093894.1, NM_001100424.1 [Q9NUQ6-2]
NP_001269664.1, NM_001282735.1 [Q9NUQ6-1]
NP_001269672.1, NM_001282743.1
NP_001269673.1, NM_001282744.1 [Q9NUQ6-3]
NP_056350.2, NM_015535.2 [Q9NUQ6-1]
XP_005246513.1, XM_005246456.1 [Q9NUQ6-1]
XP_005246514.1, XM_005246457.1 [Q9NUQ6-1]
XP_005246515.1, XM_005246458.1 [Q9NUQ6-1]
XP_005246516.1, XM_005246459.1 [Q9NUQ6-2]
XP_011509240.1, XM_011510938.1 [Q9NUQ6-3]
XP_011509241.1, XM_011510939.1 [Q9NUQ6-1]
XP_016859272.1, XM_017003783.1
XP_016859274.1, XM_017003785.1 [Q9NUQ6-2]
XP_016859275.1, XM_017003786.1 [Q9NUQ6-2]
XP_016859276.1, XM_017003787.1 [Q9NUQ6-2]

3D structure databases

SMRiQ9NUQ6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi117483, 41 interactors
IntActiQ9NUQ6, 28 interactors
MINTiQ9NUQ6
STRINGi9606.ENSP00000482515

PTM databases

iPTMnetiQ9NUQ6
PhosphoSitePlusiQ9NUQ6

Genetic variation databases

BioMutaiSPATS2L
DMDMi160185484

Proteomic databases

EPDiQ9NUQ6
jPOSTiQ9NUQ6
MassIVEiQ9NUQ6
MaxQBiQ9NUQ6
PaxDbiQ9NUQ6
PeptideAtlasiQ9NUQ6
PRIDEiQ9NUQ6
ProteomicsDBi5078
82709 [Q9NUQ6-1]
82710 [Q9NUQ6-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34086, 139 antibodies

The DNASU plasmid repository

More...
DNASUi
26010

Genome annotation databases

EnsembliENST00000358677; ENSP00000351503; ENSG00000196141 [Q9NUQ6-1]
ENST00000360760; ENSP00000353989; ENSG00000196141 [Q9NUQ6-2]
ENST00000409140; ENSP00000386730; ENSG00000196141 [Q9NUQ6-1]
ENST00000409151; ENSP00000386310; ENSG00000196141 [Q9NUQ6-4]
ENST00000409718; ENSP00000386336; ENSG00000196141 [Q9NUQ6-1]
ENST00000409988; ENSP00000386931; ENSG00000196141 [Q9NUQ6-1]
ENST00000451764; ENSP00000391467; ENSG00000196141 [Q9NUQ6-1]
ENST00000619961; ENSP00000482515; ENSG00000196141 [Q9NUQ6-3]
GeneIDi26010
KEGGihsa:26010
UCSCiuc002uvn.5, human [Q9NUQ6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26010
DisGeNETi26010

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPATS2L
HGNCiHGNC:24574, SPATS2L
HPAiENSG00000196141, Low tissue specificity
MIMi613817, gene
neXtProtiNX_Q9NUQ6
OpenTargetsiENSG00000196141
PharmGKBiPA165697465
VEuPathDBiHostDB:ENSG00000196141.12

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S51R, Eukaryota
GeneTreeiENSGT00390000001138
HOGENOMiCLU_037089_3_0_1
InParanoidiQ9NUQ6
OMAiCNLGRPK
OrthoDBi1523681at2759
PhylomeDBiQ9NUQ6
TreeFamiTF320553

Enzyme and pathway databases

PathwayCommonsiQ9NUQ6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
26010, 8 hits in 991 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPATS2L, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SPATS2L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26010
PharosiQ9NUQ6, Tbio

Protein Ontology

More...
PROi
PR:Q9NUQ6
RNActiQ9NUQ6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196141, Expressed in epithelium of bronchus and 242 other tissues
ExpressionAtlasiQ9NUQ6, baseline and differential
GenevisibleiQ9NUQ6, HS

Family and domain databases

InterProiView protein in InterPro
IPR009816, DUF1387
IPR009060, UBA-like_sf
PANTHERiPTHR15623, PTHR15623, 1 hit
PfamiView protein in Pfam
PF07139, DUF1387, 1 hit
SUPFAMiSSF46934, SSF46934, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPS2L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NUQ6
Secondary accession number(s): A8K381
, B4DRE6, B4DT67, B7WNZ7, Q53T22, Q8WV53, Q8WYG1, Q9NTW4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: June 2, 2021
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again