Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (17 Jun 2020)
Sequence version 2 (28 Mar 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Double-stranded RNA-binding protein Staufen homolog 2

Gene

STAU2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processTransport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double-stranded RNA-binding protein Staufen homolog 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STAU2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000040341.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11371 STAU2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605920 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NUL3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
27067

Open Targets

More...
OpenTargetsi
ENSG00000040341

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36189

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NUL3 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STAU2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73919458

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000722461 – 570Double-stranded RNA-binding protein Staufen homolog 2Add BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei188PhosphoserineCombined sources1
Modified residuei395PhosphoserineCombined sources1
Modified residuei405PhosphothreonineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei426PhosphoserineCombined sources1
Modified residuei440PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1
Modified residuei492PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NUL3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NUL3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NUL3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NUL3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NUL3

PeptideAtlas

More...
PeptideAtlasi
Q9NUL3

PRoteomics IDEntifications database

More...
PRIDEi
Q9NUL3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17731
19897
20012
20028
82683 [Q9NUL3-1]
82684 [Q9NUL3-2]
82685 [Q9NUL3-3]
82686 [Q9NUL3-4]
82687 [Q9NUL3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NUL3

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9NUL3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NUL3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000040341 Expressed in frontal cortex and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NUL3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NUL3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000040341 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP.

Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation (By similarity).

Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1.

Interacts with TRIM71 (via NHL repeats) in an RNA-dependent manner (PubMed:23125361).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
117978, 69 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NUL3, 52 interactors

Molecular INTeraction database

More...
MINTi
Q9NUL3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000428756

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NUL3 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NUL3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 75DRBM 1PROSITE-ProRule annotationAdd BLAST68
Domaini95 – 181DRBM 2PROSITE-ProRule annotationAdd BLAST87
Domaini207 – 274DRBM 3PROSITE-ProRule annotationAdd BLAST68
Domaini307 – 375DRBM 4PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni381 – 570Required for dendritic transportBy similarityAdd BLAST190

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi273 – 291Nuclear localization signal 1By similarityAdd BLAST19
Motifi373 – 412Nuclear localization signal 2By similarityAdd BLAST40

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export (By similarity).By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3732 Eukaryota
ENOG410XSCK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154977

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_162783_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NUL3

KEGG Orthology (KO)

More...
KOi
K17597

Identification of Orthologs from Complete Genome Data

More...
OMAi
GMINQRY

Database of Orthologous Groups

More...
OrthoDBi
823092at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NUL3

TreeFam database of animal gene trees

More...
TreeFami
TF350296

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00048 DSRM, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014720 dsRBD_dom
IPR032478 Staufen_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00035 dsrm, 4 hits
PF16482 Staufen_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00358 DSRM, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50137 DS_RBD, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NUL3-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANPKEKTAM CLVNELARFN RVQPQYKLLN ERGPAHSKMF SVQLSLGEQT
60 70 80 90 100
WESEGSSIKK AQQAVANKAL TESTLPKPVQ KPPKSNVNNN PGSITPTVEL
110 120 130 140 150
NGLAMKRGEP AIYRPLDPKP FPNYRANYNF RGMYNQRYHC PVPKIFYVQL
160 170 180 190 200
TVGNNEFFGE GKTRQAARHN AAMKALQALQ NEPIPERSPQ NGESGKDVDD
210 220 230 240 250
DKDANKSEIS LVFEIALKRN MPVSFEVIKE SGPPHMKSFV TRVSVGEFSA
260 270 280 290 300
EGEGNSKKLS KKRAATTVLQ ELKKLPPLPV VEKPKLFFKK RPKTIVKAGP
310 320 330 340 350
EYGQGMNPIS RLAQIQQAKK EKEPDYVLLS ERGMPRRREF VMQVKVGNEV
360 370 380 390 400
ATGTGPNKKI AKKNAAEAML LQLGYKASTN LQDQLEKTGE NKGWSGPKPG
410 420 430 440 450
FPEPTNNTPK GILHLSPDVY QEMEASRHKV ISGTTLGYLS PKDMNQPSSS
460 470 480 490 500
FFSISPTSNS SATIARELLM NGTSSTAEAI GLKGSSPTPP CSPVQPSKQL
510 520 530 540 550
EYLARIQGFQ AALSALKQFS EQGLDPIDGA MNIEKGSLEK QAKHLREKAD
560 570
NNQAPPGSIA QDCKKSNSAV
Length:570
Mass (Da):62,608
Last modified:March 28, 2018 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0F07B59D9456D9FA
GO
Isoform 2 (identifier: Q9NUL3-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ

Show »
Length:538
Mass (Da):58,970
Checksum:i231B73DD889F7111
GO
Isoform 3 (identifier: Q9NUL3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ
     511-511: A → V
     512-570: Missing.

Show »
Length:479
Mass (Da):52,737
Checksum:iAE7187740BA310E9
GO
Isoform 4 (identifier: Q9NUL3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-220: Missing.
     511-511: A → V
     512-570: Missing.

Show »
Length:291
Mass (Da):31,724
Checksum:i868EDBC3CFDB7840
GO
Isoform 5 (identifier: Q9NUL3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ
     138-570: Missing.

Show »
Length:105
Mass (Da):11,763
Checksum:i581E40C45AE59FDC
GO
Isoform 6 (identifier: Q9NUL3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: Missing.

Show »
Length:398
Mass (Da):43,278
Checksum:iD3596C80A0DFF202
GO
Isoform 7 (identifier: Q9NUL3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     509-509: F → FQVHYCDRQSGKECVTCLTLAPVQMTFHAIGSSIEASHD

Show »
Length:504
Mass (Da):55,414
Checksum:iCA38078E7E7DA03A
GO
Isoform 8 (identifier: Q9NUL3-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     511-570: AALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV → V

Show »
Length:473
Mass (Da):52,009
Checksum:i7C7FD9481840C355
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RFK1E5RFK1_HUMAN
Double-stranded RNA-binding protein...
STAU2
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJN7E5RJN7_HUMAN
Double-stranded RNA-binding protein...
STAU2
320Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVJ4E7EVJ4_HUMAN
Double-stranded RNA-binding protein...
STAU2
511Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ67E5RJ67_HUMAN
Double-stranded RNA-binding protein...
STAU2
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EPX0E7EPX0_HUMAN
Double-stranded RNA-binding protein...
STAU2
491Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVI1E7EVI1_HUMAN
Double-stranded RNA-binding protein...
STAU2
390Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBY0H0YBY0_HUMAN
Double-stranded RNA-binding protein...
STAU2
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGQ5E5RGQ5_HUMAN
Double-stranded RNA-binding protein...
STAU2
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGT3E5RGT3_HUMAN
Double-stranded RNA-binding protein...
STAU2
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91766 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB14522 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAH10527 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti345K → T in BAH11778 (PubMed:14702039).Curated1
Sequence conflicti433G → D in CAH10527 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023394198V → M5 PublicationsCorresponds to variant dbSNP:rs949493Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0153731 – 220Missing in isoform 4. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_0461381 – 172Missing in isoform 6. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_0461391 – 104Missing in isoform 7. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_0153741 – 38MANPK…PAHSK → MLQINQ in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST38
Alternative sequenceiVSP_0461401 – 38Missing in isoform 8. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_015375138 – 570Missing in isoform 5. 1 PublicationAdd BLAST433
Alternative sequenceiVSP_046141509F → FQVHYCDRQSGKECVTCLTL APVQMTFHAIGSSIEASHD in isoform 7. 1 Publication1
Alternative sequenceiVSP_046142511 – 570AALSA…SNSAV → V in isoform 8. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_015376511A → V in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_015377512 – 570Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y19062 mRNA Translation: CAB64341.1
AF459097 mRNA Translation: AAN37926.1
AF459098 mRNA Translation: AAN37927.1
AK001576 mRNA Translation: BAA91766.1 Different initiation.
AK002152 mRNA Translation: BAA92111.1
AK023314 mRNA Translation: BAB14522.1 Different initiation.
AK293496 mRNA Translation: BAH11522.1
AK294466 mRNA Translation: BAH11778.1
AK303104 mRNA Translation: BAH13900.1
CR627442 mRNA Translation: CAH10527.1 Different initiation.
AC018620 Genomic DNA No translation available.
AC027018 Genomic DNA No translation available.
AC100784 Genomic DNA No translation available.
KF458781 Genomic DNA No translation available.
BC008369 mRNA Translation: AAH08369.1
BC008370 mRNA Translation: AAH08370.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55244.1 [Q9NUL3-6]
CCDS55245.1 [Q9NUL3-7]
CCDS55246.1 [Q9NUL3-8]
CCDS55247.1 [Q9NUL3-1]
CCDS55248.1 [Q9NUL3-2]
CCDS6214.1 [Q9NUL3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001157852.1, NM_001164380.1 [Q9NUL3-1]
NP_001157853.1, NM_001164381.1 [Q9NUL3-2]
NP_001157854.1, NM_001164382.1 [Q9NUL3-7]
NP_001157855.1, NM_001164383.1 [Q9NUL3-6]
NP_001157856.1, NM_001164384.1 [Q9NUL3-3]
NP_001157857.1, NM_001164385.1 [Q9NUL3-8]
NP_055208.2, NM_014393.2 [Q9NUL3-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355780; ENSP00000348026; ENSG00000040341 [Q9NUL3-3]
ENST00000517542; ENSP00000431111; ENSG00000040341 [Q9NUL3-8]
ENST00000521210; ENSP00000429173; ENSG00000040341 [Q9NUL3-7]
ENST00000521451; ENSP00000428476; ENSG00000040341 [Q9NUL3-4]
ENST00000522509; ENSP00000427977; ENSG00000040341 [Q9NUL3-3]
ENST00000522695; ENSP00000428456; ENSG00000040341 [Q9NUL3-2]
ENST00000523558; ENSP00000428741; ENSG00000040341 [Q9NUL3-6]
ENST00000524104; ENSP00000430611; ENSG00000040341 [Q9NUL3-5]
ENST00000524300; ENSP00000428756; ENSG00000040341 [Q9NUL3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27067

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:27067

UCSC genome browser

More...
UCSCi
uc003xzs.5 human [Q9NUL3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y19062 mRNA Translation: CAB64341.1
AF459097 mRNA Translation: AAN37926.1
AF459098 mRNA Translation: AAN37927.1
AK001576 mRNA Translation: BAA91766.1 Different initiation.
AK002152 mRNA Translation: BAA92111.1
AK023314 mRNA Translation: BAB14522.1 Different initiation.
AK293496 mRNA Translation: BAH11522.1
AK294466 mRNA Translation: BAH11778.1
AK303104 mRNA Translation: BAH13900.1
CR627442 mRNA Translation: CAH10527.1 Different initiation.
AC018620 Genomic DNA No translation available.
AC027018 Genomic DNA No translation available.
AC100784 Genomic DNA No translation available.
KF458781 Genomic DNA No translation available.
BC008369 mRNA Translation: AAH08369.1
BC008370 mRNA Translation: AAH08370.1
CCDSiCCDS55244.1 [Q9NUL3-6]
CCDS55245.1 [Q9NUL3-7]
CCDS55246.1 [Q9NUL3-8]
CCDS55247.1 [Q9NUL3-1]
CCDS55248.1 [Q9NUL3-2]
CCDS6214.1 [Q9NUL3-3]
RefSeqiNP_001157852.1, NM_001164380.1 [Q9NUL3-1]
NP_001157853.1, NM_001164381.1 [Q9NUL3-2]
NP_001157854.1, NM_001164382.1 [Q9NUL3-7]
NP_001157855.1, NM_001164383.1 [Q9NUL3-6]
NP_001157856.1, NM_001164384.1 [Q9NUL3-3]
NP_001157857.1, NM_001164385.1 [Q9NUL3-8]
NP_055208.2, NM_014393.2 [Q9NUL3-3]

3D structure databases

SMRiQ9NUL3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi117978, 69 interactors
IntActiQ9NUL3, 52 interactors
MINTiQ9NUL3
STRINGi9606.ENSP00000428756

PTM databases

iPTMnetiQ9NUL3
MetOSiteiQ9NUL3
PhosphoSitePlusiQ9NUL3

Polymorphism and mutation databases

BioMutaiSTAU2
DMDMi73919458

Proteomic databases

EPDiQ9NUL3
jPOSTiQ9NUL3
MassIVEiQ9NUL3
MaxQBiQ9NUL3
PaxDbiQ9NUL3
PeptideAtlasiQ9NUL3
PRIDEiQ9NUL3
ProteomicsDBi17731
19897
20012
20028
82683 [Q9NUL3-1]
82684 [Q9NUL3-2]
82685 [Q9NUL3-3]
82686 [Q9NUL3-4]
82687 [Q9NUL3-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1305 229 antibodies

The DNASU plasmid repository

More...
DNASUi
27067

Genome annotation databases

EnsembliENST00000355780; ENSP00000348026; ENSG00000040341 [Q9NUL3-3]
ENST00000517542; ENSP00000431111; ENSG00000040341 [Q9NUL3-8]
ENST00000521210; ENSP00000429173; ENSG00000040341 [Q9NUL3-7]
ENST00000521451; ENSP00000428476; ENSG00000040341 [Q9NUL3-4]
ENST00000522509; ENSP00000427977; ENSG00000040341 [Q9NUL3-3]
ENST00000522695; ENSP00000428456; ENSG00000040341 [Q9NUL3-2]
ENST00000523558; ENSP00000428741; ENSG00000040341 [Q9NUL3-6]
ENST00000524104; ENSP00000430611; ENSG00000040341 [Q9NUL3-5]
ENST00000524300; ENSP00000428756; ENSG00000040341 [Q9NUL3-1]
GeneIDi27067
KEGGihsa:27067
UCSCiuc003xzs.5 human [Q9NUL3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27067
DisGeNETi27067
EuPathDBiHostDB:ENSG00000040341.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STAU2
HGNCiHGNC:11371 STAU2
HPAiENSG00000040341 Low tissue specificity
MIMi605920 gene
neXtProtiNX_Q9NUL3
OpenTargetsiENSG00000040341
PharmGKBiPA36189

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3732 Eukaryota
ENOG410XSCK LUCA
GeneTreeiENSGT00940000154977
HOGENOMiCLU_162783_0_0_1
InParanoidiQ9NUL3
KOiK17597
OMAiGMINQRY
OrthoDBi823092at2759
PhylomeDBiQ9NUL3
TreeFamiTF350296

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
27067 4 hits in 792 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STAU2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
STAU2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
27067
PharosiQ9NUL3 Tbio

Protein Ontology

More...
PROi
PR:Q9NUL3
RNActiQ9NUL3 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000040341 Expressed in frontal cortex and 220 other tissues
ExpressionAtlasiQ9NUL3 baseline and differential
GenevisibleiQ9NUL3 HS

Family and domain databases

CDDicd00048 DSRM, 4 hits
InterProiView protein in InterPro
IPR014720 dsRBD_dom
IPR032478 Staufen_C
PfamiView protein in Pfam
PF00035 dsrm, 4 hits
PF16482 Staufen_C, 1 hit
SMARTiView protein in SMART
SM00358 DSRM, 4 hits
PROSITEiView protein in PROSITE
PS50137 DS_RBD, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTAU2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NUL3
Secondary accession number(s): A0A0A0MTC5
, B7Z1I6, B7Z292, B7Z8B4, E7ER74, E9PEI3, E9PF26, E9PF50, Q6AHY7, Q96HM0, Q96HM1, Q9NVI5, Q9UGG6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: March 28, 2018
Last modified: June 17, 2020
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again