Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (31 Jul 2019)
Sequence version 3 (30 Apr 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 64

Gene

ZFP64

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri175 – 197C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri203 – 225C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri231 – 253C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 324C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri330 – 352C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 380C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri386 – 408C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 436C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri442 – 465C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri467 – 489C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri495 – 517C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri523 – 546C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri580 – 602C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 64Curated
Short name:
Zfp-64
Alternative name(s):
Zinc finger protein 338Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZFP64Imported
Synonyms:ZNF338Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15940 ZFP64

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618111 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NTW7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55734

Open Targets

More...
OpenTargetsi
ENSG00000020256

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38060

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZFP64

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242854
30316391

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000473081 – 645Zinc finger protein 64Add BLAST645

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 6 (identifier: Q9NTW7-4)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki286Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki397Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei545PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NTW7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NTW7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NTW7

PeptideAtlas

More...
PeptideAtlasi
Q9NTW7

PRoteomics IDEntifications database

More...
PRIDEi
Q9NTW7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
63393
81951
81952
82633 [Q9NTW7-1]
82634 [Q9NTW7-2]
82635 [Q9NTW7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NTW7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NPA5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000020256 Expressed in 231 organ(s), highest expression level in vagina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NTW7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NTW7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035112
HPA058387

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120853, 34 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NTW7, 24 interactors

Molecular INTeraction database

More...
MINTi
Q9NTW7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000216923

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1645
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NTW7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri175 – 197C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri203 – 225C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri231 – 253C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 324C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri330 – 352C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 380C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri386 – 408C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri414 – 436C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri442 – 465C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri467 – 489C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri495 – 517C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri523 – 546C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri580 – 602C2H2-type 13PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230887

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NPA5

Identification of Orthologs from Complete Genome Data

More...
OMAi
VRCAMKG

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

TreeFam database of animal gene trees

More...
TreeFami
TF333046

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 6 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 15 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 8 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 6 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q9NTW7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNASSEGESF AGSVQIPGGT TVLVELTPDI HICGICKQQF NNLDAFVAHK
60 70 80 90 100
QSGCQLTGTS AAAPSTVQFV SEETVPATQT QTTTRTITSE TQTITVSAPE
110 120 130 140 150
FVFEHGYQTY LPTESNENQT ATVISLPAKS RTKKPTTPPA QKRLNCCYPG
160 170 180 190 200
CQFKTAYGMK DMERHLKIHT GDKPHKCEVC GKCFSRKDKL KTHMRCHTGV
210 220 230 240 250
KPYKCKTCDY AAADSSSLNK HLRIHSDERP FKCQICPYAS RNSSQLTVHL
260 270 280 290 300
RSHTASELDD DVPKANCLST ESTDTPKAPV ITLPSEAREQ MATLGERTFN
310 320 330 340 350
CCYPGCHFKT VHGMKDLDRH LRIHTGDKPH KCEFCDKCFS RKDNLTMHMR
360 370 380 390 400
CHTSVKPHKC HLCDYAAVDS SSLKKHLRIH SDERPYKCQL CPYASRNSSQ
410 420 430 440 450
LTVHLRSHTG DTPFQCWLCS AKFKISSDLK RHMIVHSGEK PFKCEFCDVR
460 470 480 490 500
CTMKANLKSH IRIKHTFKCL HCAFQGRDRA DLLEHSRLHQ ADHPEKCPEC
510 520 530 540 550
SYSCSSAAAL RVHSRVHCKD RPFKCDFCSF DTKRPSSLAK HVDKVHRDEA
560 570 580 590 600
KTENRAPLGK EGLREGSSQH VAKIVTQRAF RCETCGASFV RDDSLRCHKK
610 620 630 640
QHSDQSENKN SDLVTFPPES GASGQLSTLV SVGQLEAPLE PSQDL
Length:645
Mass (Da):72,217
Last modified:April 30, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD7D336A59C128CC0
GO
Isoform 4 (identifier: Q9NTW7-2) [UniParc]FASTAAdd to basket
Also known as: ZNF338

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-254: KHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHT → MSRRKQAKPQHLNSEEPRPARRECAEVAPQVAGEP

Show »
Length:426
Mass (Da):48,165
Checksum:i1058B24E5147E9C7
GO
Isoform 5 (identifier: Q9NTW7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-415: DTPFQ → CCYVA
     416-645: Missing.

Show »
Length:415
Mass (Da):46,253
Checksum:iFF37B0E6DE035CF7
GO
Isoform 6 (identifier: Q9NTW7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-18: IPG → S
     236-390: Missing.
     412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD

Note: Gene prediction based on EST data.Combined sources
Show »
Length:679
Mass (Da):74,463
Checksum:iED2C59DD4F6BEC4D
GO
Isoform 1 (identifier: Q9NTW7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-390: Missing.
     412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD

Show »
Length:681
Mass (Da):74,644
Checksum:i949C2DB54BB97E2E
GO
Isoform 2 (identifier: Q9NTW7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-149: Missing.
     236-390: Missing.
     412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD

Show »
Length:627
Mass (Da):68,621
Checksum:iA4EE9B17845C00EF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2A2N5A2A2N5_HUMAN
Zinc finger protein 64
ZFP64
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y669H0Y669_HUMAN
Zinc finger protein 64
ZFP64
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2A2N6A2A2N6_HUMAN
Zinc finger protein 64
ZFP64
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD96432 differs from that shown. Reason: Erroneous translation. Translation C-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti240S → G in BAD96432 (Ref. 3) Curated1
Sequence conflicti521R → C in AAP88762 (Ref. 2) Curated1
Sequence conflicti521R → C in BC021087 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02801968Q → P. Corresponds to variant dbSNP:rs7353222Ensembl.1
Natural variantiVAR_028020139P → L. Corresponds to variant dbSNP:rs6021773Ensembl.1
Natural variantiVAR_035564593D → E in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_035565609K → N in a breast cancer sample; somatic mutation. 1 Publication1
Isoform 1 (identifier: Q9NTW7-5)
Natural varianti425F → Y2 PublicationsCorresponds to variant dbSNP:rs16996517Ensembl.1
Natural varianti451S → N2 PublicationsCorresponds to variant dbSNP:rs3746414Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0072851 – 219Missing in isoform 4. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_04689616 – 18IPG → S in isoform 6. Curated3
Alternative sequenceiVSP_06009296 – 149Missing in isoform 2. Add BLAST54
Alternative sequenceiVSP_007286220 – 254KHLRI…LRSHT → MSRRKQAKPQHLNSEEPRPA RRECAEVAPQVAGEP in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_046897236 – 390Missing in isoform 6, isoform 1 and isoform 2. CuratedAdd BLAST155
Alternative sequenceiVSP_038213411 – 415DTPFQ → CCYVA in isoform 5. 1 Publication5
Alternative sequenceiVSP_046898412 – 645TPFQC…PSQDL → APFQCWLCSAKFKISSDLKR HMRVHSGEKPFKCEFCNVRC TMKGNLKSHIRIKHSGNNFK CPHCDFLGDSKATLRKHSRV HQSEHPEKCSECSYSCSSKA ALRIHERIHCTDRPFKCNYC SFDTKQPSNLSKHMKKFHGD MVKTEALERKDTGRQSSRQV AKLDAKKSFHCDICDASFMR EDSLRSHKRQHSEYSESKNS DVTVLQFQIDPSKQPATPLT VGHLQVPLQPSQVPQFSEGR VKIIVGHQVPQANTIVQAAA AAVNIVPPALVAQNPEELPG NSRLQILRQVSLIAPPQSSR CPSEAGAMTQPAVLLTTHEQ TDGATLHQTLIPTASGGPQE GSGNQTFITSSGITCTDFEG LNALIQEGTAEVTVVSDGGQ NIAVATTAPPVFSSSSQQEL PKQTYSIIQGAAHPALLCPA DSIPD in isoform 6, isoform 1 and isoform 2. CuratedAdd BLAST234
Alternative sequenceiVSP_038214416 – 645Missing in isoform 5. 1 PublicationAdd BLAST230

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001596 mRNA Translation: BAA91777.1
AK001744 mRNA Translation: BAA91876.1
AK022690 mRNA Translation: BAB14182.1
BT009760 mRNA Translation: AAP88762.1
AK222712 mRNA Translation: BAD96432.1 Sequence problems.
AL109984 Genomic DNA No translation available.
AL121771 Genomic DNA No translation available.
AL121923 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75591.1
BC021087 mRNA No translation available.
BC012759 mRNA Translation: AAH12759.1
BC041622 mRNA Translation: AAH41622.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13439.1 [Q9NTW7-1]
CCDS13440.1 [Q9NTW7-5]
CCDS13441.1 [Q9NTW7-6]
CCDS13442.1 [Q9NTW7-4]
CCDS82630.1 [Q9NTW7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001306075.1, NM_001319146.1 [Q9NTW7-2]
NP_060667.2, NM_018197.2 [Q9NTW7-5]
NP_071371.3, NM_022088.4 [Q9NTW7-6]
NP_955458.1, NM_199426.1 [Q9NTW7-4]
NP_955459.2, NM_199427.2 [Q9NTW7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000216923; ENSP00000216923; ENSG00000020256 [Q9NTW7-5]
ENST00000346617; ENSP00000344615; ENSG00000020256 [Q9NTW7-6]
ENST00000361387; ENSP00000355179; ENSG00000020256 [Q9NTW7-1]
ENST00000371515; ENSP00000360570; ENSG00000020256 [Q9NTW7-4]
ENST00000371518; ENSP00000360573; ENSG00000020256 [Q9NTW7-3]
ENST00000371523; ENSP00000360578; ENSG00000020256 [Q9NTW7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55734

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55734

UCSC genome browser

More...
UCSCi
uc002xwj.4 human [Q9NTW7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001596 mRNA Translation: BAA91777.1
AK001744 mRNA Translation: BAA91876.1
AK022690 mRNA Translation: BAB14182.1
BT009760 mRNA Translation: AAP88762.1
AK222712 mRNA Translation: BAD96432.1 Sequence problems.
AL109984 Genomic DNA No translation available.
AL121771 Genomic DNA No translation available.
AL121923 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75591.1
BC021087 mRNA No translation available.
BC012759 mRNA Translation: AAH12759.1
BC041622 mRNA Translation: AAH41622.1
CCDSiCCDS13439.1 [Q9NTW7-1]
CCDS13440.1 [Q9NTW7-5]
CCDS13441.1 [Q9NTW7-6]
CCDS13442.1 [Q9NTW7-4]
CCDS82630.1 [Q9NTW7-2]
RefSeqiNP_001306075.1, NM_001319146.1 [Q9NTW7-2]
NP_060667.2, NM_018197.2 [Q9NTW7-5]
NP_071371.3, NM_022088.4 [Q9NTW7-6]
NP_955458.1, NM_199426.1 [Q9NTW7-4]
NP_955459.2, NM_199427.2 [Q9NTW7-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X5WNMR-A-[»]
2DMDNMR-A174-235[»]
SMRiQ9NTW7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120853, 34 interactors
IntActiQ9NTW7, 24 interactors
MINTiQ9NTW7
STRINGi9606.ENSP00000216923

PTM databases

iPTMnetiQ9NTW7
PhosphoSitePlusiQ9NPA5

Polymorphism and mutation databases

BioMutaiZFP64
DMDMi116242854
30316391

Proteomic databases

EPDiQ9NTW7
jPOSTiQ9NTW7
MaxQBiQ9NTW7
PeptideAtlasiQ9NTW7
PRIDEiQ9NTW7
ProteomicsDBi63393
81951
81952
82633 [Q9NTW7-1]
82634 [Q9NTW7-2]
82635 [Q9NTW7-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55734
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216923; ENSP00000216923; ENSG00000020256 [Q9NTW7-5]
ENST00000346617; ENSP00000344615; ENSG00000020256 [Q9NTW7-6]
ENST00000361387; ENSP00000355179; ENSG00000020256 [Q9NTW7-1]
ENST00000371515; ENSP00000360570; ENSG00000020256 [Q9NTW7-4]
ENST00000371518; ENSP00000360573; ENSG00000020256 [Q9NTW7-3]
ENST00000371523; ENSP00000360578; ENSG00000020256 [Q9NTW7-2]
GeneIDi55734
KEGGihsa:55734
UCSCiuc002xwj.4 human [Q9NTW7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55734
DisGeNETi55734

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZFP64
HGNCiHGNC:15940 ZFP64
HPAiHPA035112
HPA058387
MIMi618111 gene
neXtProtiNX_Q9NTW7
OpenTargetsiENSG00000020256
PharmGKBiPA38060

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000156405
HOGENOMiHOG000230887
InParanoidiQ9NPA5
OMAiVRCAMKG
OrthoDBi1318335at2759
TreeFamiTF333046

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZFP64 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZFP64

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55734

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000020256 Expressed in 231 organ(s), highest expression level in vagina
ExpressionAtlasiQ9NTW7 baseline and differential
GenevisibleiQ9NTW7 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 6 hits
PS50157 ZINC_FINGER_C2H2_2, 13 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZF64B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NTW7
Secondary accession number(s): A2A2N4
, Q53H69, Q53XQ1, Q5JWM0, Q5JWM1, Q8WU98, Q9H9P1, Q9NPA5, Q9NTS7, Q9NVH4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: April 30, 2003
Last modified: July 31, 2019
This is version 175 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again