Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (31 Jul 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter

Gene

SLC35D1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm into the endoplasmic reticulum lumen (PubMed:11322953, PubMed:17952091). Plays a role in chondroitin sulfate biosynthesis, which is important for formation of cartilage extracellular matrix and normal skeletal development (By similarity).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSugar transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-173599 Formation of the active cofactor, UDP-glucuronate
R-HSA-5579020 Defective SLC35D1 causes Schneckenbecken dysplasia (SCHBCKD)
R-HSA-727802 Transport of nucleotide sugars

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.7.15.4 the drug/metabolite transporter (dmt) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
Short name:
UDP-GlcA/UDP-GalNAc transporter
Alternative name(s):
Solute carrier family 35 member D1
UDP-galactose transporter-related protein 7
Short name:
UGTrel7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC35D1
Synonyms:KIAA0260, UGTREL7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20800 SLC35D1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610804 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NTN3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei37 – 59HelicalSequence analysisAdd BLAST23
Transmembranei69 – 88HelicalSequence analysisAdd BLAST20
Transmembranei158 – 177HelicalSequence analysisAdd BLAST20
Transmembranei187 – 205HelicalSequence analysisAdd BLAST19
Transmembranei217 – 239HelicalSequence analysisAdd BLAST23
Transmembranei254 – 276HelicalSequence analysisAdd BLAST23
Transmembranei281 – 303HelicalSequence analysisAdd BLAST23
Transmembranei308 – 330HelicalSequence analysisAdd BLAST23

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Schneckenbecken dysplasia (SHNKND)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare, lethal autosomal recessive skeletal dysplasia characterized by snail-like configuration of the hypoplastic iliac bone, short-limbed dwarfism, short ribs, and flattened, hypoplastic vertebral bodies. SHNKND is lethal in the neonatal period.
Related information in OMIM

Keywords - Diseasei

Dwarfism

Organism-specific databases

DisGeNET

More...
DisGeNETi
23169

MalaCards human disease database

More...
MalaCardsi
SLC35D1
MIMi269250 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000116704

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
3144 Schneckenbecken dysplasia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134978757

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC35D1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20140875

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002133941 – 355UDP-glucuronic acid/UDP-N-acetylgalactosamine transporterAdd BLAST355

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NTN3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NTN3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NTN3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NTN3

PeptideAtlas

More...
PeptideAtlasi
Q9NTN3

PRoteomics IDEntifications database

More...
PRIDEi
Q9NTN3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
6551
82626 [Q9NTN3-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NTN3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NTN3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116704 Expressed in 221 organ(s), highest expression level in secondary oocyte

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NTN3 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116781, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000235345

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1444 Eukaryota
COG5070 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155665

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000038339

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NTN3

KEGG Orthology (KO)

More...
KOi
K15281

Identification of Orthologs from Complete Genome Data

More...
OMAi
KAWFPIS

Database of Orthologous Groups

More...
OrthoDBi
1093260at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NTN3

TreeFam database of animal gene trees

More...
TreeFami
TF313307

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004853 Sugar_P_trans_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03151 TPT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NTN3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEVHRRQHA RVKGEAPAKS STLRDEEELG MASAETLTVF LKLLAAGFYG
60 70 80 90 100
VSSFLIVVVN KSVLTNYRFP SSLCVGLGQM VATVAVLWVG KALRVVKFPD
110 120 130 140 150
LDRNVPRKTF PLPLLYFGNQ ITGLFSTKKL NLPMFTVLRR FSILFTMFAE
160 170 180 190 200
GVLLKKTFSW GIKMTVFAMI IGAFVAASSD LAFDLEGYAF ILINDVLTAA
210 220 230 240 250
NGAYVKQKLD SKELGKYGLL YYNALFMILP TLAIAYFTGD AQKAVEFEGW
260 270 280 290 300
ADTLFLLQFT LSCVMGFILM YATVLCTQYN SALTTTIVGC IKNILITYIG
310 320 330 340 350
MVFGGDYIFT WTNFIGLNIS IAGSLVYSYI TFTEEQLSKQ SEANNKLDIK

GKGAV
Length:355
Mass (Da):39,240
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCAFF15D49605CA27
GO
Isoform 2 (identifier: Q9NTN3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.
     321-355: IAGSLVYSYITFTEEQLSKQSEANNKLDIKGKGAV → CICHRGLCELRVGSATLGG

Note: No experimental confirmation available.
Show »
Length:260
Mass (Da):28,816
Checksum:i11489C2DA27E8DFD
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA13390 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04272982A → T. Corresponds to variant dbSNP:rs10157422Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0568601 – 79Missing in isoform 2. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_056861321 – 355IAGSL…GKGAV → CICHRGLCELRVGSATLGG in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB044343 mRNA Translation: BAB18586.1
D87449 mRNA Translation: BAA13390.1 Different initiation.
AK289800 mRNA Translation: BAF82489.1
AK296449 mRNA Translation: BAH12358.1
AL133320 Genomic DNA No translation available.
BC093786 mRNA Translation: AAH93786.1
BC112031 mRNA Translation: AAI12032.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS636.1 [Q9NTN3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055954.1, NM_015139.2 [Q9NTN3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000235345; ENSP00000235345; ENSG00000116704 [Q9NTN3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23169

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23169

UCSC genome browser

More...
UCSCi
uc001ddk.3 human [Q9NTN3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB044343 mRNA Translation: BAB18586.1
D87449 mRNA Translation: BAA13390.1 Different initiation.
AK289800 mRNA Translation: BAF82489.1
AK296449 mRNA Translation: BAH12358.1
AL133320 Genomic DNA No translation available.
BC093786 mRNA Translation: AAH93786.1
BC112031 mRNA Translation: AAI12032.1
CCDSiCCDS636.1 [Q9NTN3-1]
RefSeqiNP_055954.1, NM_015139.2 [Q9NTN3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi116781, 2 interactors
STRINGi9606.ENSP00000235345

Protein family/group databases

TCDBi2.A.7.15.4 the drug/metabolite transporter (dmt) superfamily

PTM databases

iPTMnetiQ9NTN3
PhosphoSitePlusiQ9NTN3

Polymorphism and mutation databases

BioMutaiSLC35D1
DMDMi20140875

Proteomic databases

EPDiQ9NTN3
jPOSTiQ9NTN3
MaxQBiQ9NTN3
PaxDbiQ9NTN3
PeptideAtlasiQ9NTN3
PRIDEiQ9NTN3
ProteomicsDBi6551
82626 [Q9NTN3-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000235345; ENSP00000235345; ENSG00000116704 [Q9NTN3-1]
GeneIDi23169
KEGGihsa:23169
UCSCiuc001ddk.3 human [Q9NTN3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23169
DisGeNETi23169

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC35D1
HGNCiHGNC:20800 SLC35D1
MalaCardsiSLC35D1
MIMi269250 phenotype
610804 gene
neXtProtiNX_Q9NTN3
OpenTargetsiENSG00000116704
Orphaneti3144 Schneckenbecken dysplasia
PharmGKBiPA134978757

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1444 Eukaryota
COG5070 LUCA
GeneTreeiENSGT00940000155665
HOGENOMiHOG000038339
InParanoidiQ9NTN3
KOiK15281
OMAiKAWFPIS
OrthoDBi1093260at2759
PhylomeDBiQ9NTN3
TreeFamiTF313307

Enzyme and pathway databases

ReactomeiR-HSA-173599 Formation of the active cofactor, UDP-glucuronate
R-HSA-5579020 Defective SLC35D1 causes Schneckenbecken dysplasia (SCHBCKD)
R-HSA-727802 Transport of nucleotide sugars

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC35D1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23169

Protein Ontology

More...
PROi
PR:Q9NTN3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116704 Expressed in 221 organ(s), highest expression level in secondary oocyte
GenevisibleiQ9NTN3 HS

Family and domain databases

InterProiView protein in InterPro
IPR004853 Sugar_P_trans_dom
PfamiView protein in Pfam
PF03151 TPT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS35D1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NTN3
Secondary accession number(s): A8K185
, B7Z3X2, Q52LU5, Q92548
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: October 1, 2000
Last modified: July 31, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again