Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (12 Aug 2020)
Sequence version 2 (25 Nov 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Obg-like ATPase 1

Gene

OLA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.UniRule annotation

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi36MagnesiumPROSITE-ProRule annotation1
Metal bindingi56MagnesiumPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei231ATP; via carbonyl oxygen1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi32 – 37ATP1 Publication6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NTK5

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114608, Platelet degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Obg-like ATPase 1UniRule annotation
Alternative name(s):
DNA damage-regulated overexpressed in cancer 45
Short name:
DOC45
GTP-binding protein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OLA1UniRule annotation
Synonyms:GTPBP9
ORF Names:PRO2455, PTD004
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138430.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28833, OLA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611175, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NTK5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi127F → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi230N → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi231 – 233LSE → KSD: Retention of ATP-binding specificity. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
29789

Open Targets

More...
OpenTargetsi
ENSG00000138430

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162398388

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NTK5, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4105704

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
OLA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
25453240

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001224561 – 396Obg-like ATPase 1Add BLAST396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei294N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NTK5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NTK5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NTK5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NTK5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NTK5

PeptideAtlas

More...
PeptideAtlasi
Q9NTK5

PRoteomics IDEntifications database

More...
PRIDEi
Q9NTK5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
82622 [Q9NTK5-1]
82623 [Q9NTK5-2]
82624 [Q9NTK5-3]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
Q9NTK5

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q9NTK5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NTK5

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9NTK5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NTK5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9NTK5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Strongly down-regulated by DNA damage-inducing agents.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138430, Expressed in cervix squamous epithelium and 246 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NTK5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NTK5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000138430, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

UniRule annotation1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
118917, 68 interactors

Database of interacting proteins

More...
DIPi
DIP-34591N

Protein interaction database and analysis system

More...
IntActi
Q9NTK5, 20 interactors

Molecular INTeraction database

More...
MINTi
Q9NTK5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000284719

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NTK5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1396
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NTK5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NTK5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 283OBG-type GPROSITE-ProRule annotationAdd BLAST261
Domaini304 – 387TGSPROSITE-ProRule annotationAdd BLAST84

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi267 – 274Nuclear export signalUniRule annotation8

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1491, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000673

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018395_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NTK5

KEGG Orthology (KO)

More...
KOi
K19788

Database of Orthologous Groups

More...
OrthoDBi
738371at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NTK5

TreeFam database of animal gene trees

More...
TreeFami
TF300774

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04867, TGS_YchF_OLA1, 1 hit
cd01900, YchF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.300, 1 hit
3.10.20.30, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00944, YchF_OLA1_ATPase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004396, ATPase_YchF/OLA1
IPR012675, Beta-grasp_dom_sf
IPR031167, G_OBG
IPR006073, GTP_binding_domain
IPR027417, P-loop_NTPase
IPR012676, TGS-like
IPR023192, TGS-like_dom_sf
IPR013029, YchF_C
IPR041706, YchF_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01926, MMR_HSR1, 1 hit
PF06071, YchF-GTPase_C, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF006641, CHP00092, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00326, GTP1OBG

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit
SSF81271, SSF81271, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00092, TIGR00092, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51710, G_OBG, 1 hit
PS51880, TGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NTK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPPKKGGDGI KPPPIIGRFG TSLKIGIVGL PNVGKSTFFN VLTNSQASAE
60 70 80 90 100
NFPFCTIDPN ESRVPVPDER FDFLCQYHKP ASKIPAFLNV VDIAGLVKGA
110 120 130 140 150
HNGQGLGNAF LSHISACDGI FHLTRAFEDD DITHVEGSVD PIRDIEIIHE
160 170 180 190 200
ELQLKDEEMI GPIIDKLEKV AVRGGDKKLK PEYDIMCKVK SWVIDQKKPV
210 220 230 240 250
RFYHDWNDKE IEVLNKHLFL TSKPMVYLVN LSEKDYIRKK NKWLIKIKEW
260 270 280 290 300
VDKYDPGALV IPFSGALELK LQELSAEERQ KYLEANMTQS ALPKIIKAGF
310 320 330 340 350
AALQLEYFFT AGPDEVRAWT IRKGTKAPQA AGKIHTDFEK GFIMAEVMKY
360 370 380 390
EDFKEEGSEN AVKAAGKYRQ QGRNYIVEDG DIIFFKFNTP QQPKKK
Length:396
Mass (Da):44,744
Last modified:November 25, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C7629BFC27CBEB2
GO
Isoform 2 (identifier: Q9NTK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-158: Missing.

Show »
Length:238
Mass (Da):27,584
Checksum:i33A74AFEC0331464
GO
Isoform 3 (identifier: Q9NTK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-278: IKIKEWVDKYDPGALVIPFSGALELKLQELSAEE → LESTDNKAEIILLKMEILSSSNLTHLNNRRRNKI
     279-396: Missing.

Show »
Length:278
Mass (Da):31,440
Checksum:iDDB37373907EB18D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KQ32J3KQ32_HUMAN
Obg-like ATPase 1
OLA1
416Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTK6C9JTK6_HUMAN
Obg-like ATPase 1
OLA1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCJ9C9JCJ9_HUMAN
Obg-like ATPase 1
OLA1
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti33V → A in BAB55174 (PubMed:14702039).Curated1
Sequence conflicti97V → A in AAD44500 (Ref. 4) Curated1
Sequence conflicti254Y → C in CAB66481 (PubMed:11230166).Curated1
Sequence conflicti391Q → R in AAF71123 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036613168E → Q in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0020491 – 158Missing in isoform 2. 2 PublicationsAdd BLAST158
Alternative sequenceiVSP_002050245 – 278IKIKE…LSAEE → LESTDNKAEIILLKMEILSS SNLTHLNNRRRNKI in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_002051279 – 396Missing in isoform 3. 1 PublicationAdd BLAST118

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ250006 mRNA Translation: ABB72766.1
AF134478 mRNA Translation: AAP97255.1
AL136546 mRNA Translation: CAB66481.1
AF078859 mRNA Translation: AAD44491.1
AF078868 mRNA Translation: AAD44500.1
AF116703 mRNA Translation: AAF71123.1
AK027523 mRNA Translation: BAB55174.1
AK074710 mRNA Translation: BAC11153.1
CH471058 Genomic DNA Translation: EAX11151.1
BC012842 mRNA Translation: AAH12842.1
BC013925 mRNA Translation: AAH13925.1
BC029376 mRNA Translation: AAH29376.1
BC091522 mRNA Translation: AAH91522.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2255.1 [Q9NTK5-1]
CCDS42779.1 [Q9NTK5-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46901

NCBI Reference Sequences

More...
RefSeqi
NP_001011708.1, NM_001011708.2 [Q9NTK5-2]
NP_037473.3, NM_013341.4 [Q9NTK5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000284719; ENSP00000284719; ENSG00000138430 [Q9NTK5-1]
ENST00000344357; ENSP00000340167; ENSG00000138430 [Q9NTK5-2]
ENST00000428402; ENSP00000410385; ENSG00000138430 [Q9NTK5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29789

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29789

UCSC genome browser

More...
UCSCi
uc002uih.4, human [Q9NTK5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ250006 mRNA Translation: ABB72766.1
AF134478 mRNA Translation: AAP97255.1
AL136546 mRNA Translation: CAB66481.1
AF078859 mRNA Translation: AAD44491.1
AF078868 mRNA Translation: AAD44500.1
AF116703 mRNA Translation: AAF71123.1
AK027523 mRNA Translation: BAB55174.1
AK074710 mRNA Translation: BAC11153.1
CH471058 Genomic DNA Translation: EAX11151.1
BC012842 mRNA Translation: AAH12842.1
BC013925 mRNA Translation: AAH13925.1
BC029376 mRNA Translation: AAH29376.1
BC091522 mRNA Translation: AAH91522.1
CCDSiCCDS2255.1 [Q9NTK5-1]
CCDS42779.1 [Q9NTK5-2]
PIRiT46901
RefSeqiNP_001011708.1, NM_001011708.2 [Q9NTK5-2]
NP_037473.3, NM_013341.4 [Q9NTK5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OHFX-ray2.70A1-396[»]
SMRiQ9NTK5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi118917, 68 interactors
DIPiDIP-34591N
IntActiQ9NTK5, 20 interactors
MINTiQ9NTK5
STRINGi9606.ENSP00000284719

Chemistry databases

ChEMBLiCHEMBL4105704

PTM databases

iPTMnetiQ9NTK5
MetOSiteiQ9NTK5
PhosphoSitePlusiQ9NTK5
SwissPalmiQ9NTK5

Polymorphism and mutation databases

BioMutaiOLA1
DMDMi25453240

2D gel databases

OGPiQ9NTK5
UCD-2DPAGEiQ9NTK5

Proteomic databases

EPDiQ9NTK5
jPOSTiQ9NTK5
MassIVEiQ9NTK5
MaxQBiQ9NTK5
PaxDbiQ9NTK5
PeptideAtlasiQ9NTK5
PRIDEiQ9NTK5
ProteomicsDBi82622 [Q9NTK5-1]
82623 [Q9NTK5-2]
82624 [Q9NTK5-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
19452, 276 antibodies

The DNASU plasmid repository

More...
DNASUi
29789

Genome annotation databases

EnsembliENST00000284719; ENSP00000284719; ENSG00000138430 [Q9NTK5-1]
ENST00000344357; ENSP00000340167; ENSG00000138430 [Q9NTK5-2]
ENST00000428402; ENSP00000410385; ENSG00000138430 [Q9NTK5-3]
GeneIDi29789
KEGGihsa:29789
UCSCiuc002uih.4, human [Q9NTK5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29789
DisGeNETi29789
EuPathDBiHostDB:ENSG00000138430.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
OLA1
HGNCiHGNC:28833, OLA1
HPAiENSG00000138430, Low tissue specificity
MIMi611175, gene
neXtProtiNX_Q9NTK5
OpenTargetsiENSG00000138430
PharmGKBiPA162398388

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1491, Eukaryota
GeneTreeiENSGT00390000000673
HOGENOMiCLU_018395_1_0_1
InParanoidiQ9NTK5
KOiK19788
OrthoDBi738371at2759
PhylomeDBiQ9NTK5
TreeFamiTF300774

Enzyme and pathway databases

PathwayCommonsiQ9NTK5
ReactomeiR-HSA-114608, Platelet degranulation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
29789, 157 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
OLA1, human
EvolutionaryTraceiQ9NTK5

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
OLA1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29789
PharosiQ9NTK5, Tbio

Protein Ontology

More...
PROi
PR:Q9NTK5
RNActiQ9NTK5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138430, Expressed in cervix squamous epithelium and 246 other tissues
ExpressionAtlasiQ9NTK5, baseline and differential
GenevisibleiQ9NTK5, HS

Family and domain databases

CDDicd04867, TGS_YchF_OLA1, 1 hit
cd01900, YchF, 1 hit
Gene3Di1.10.150.300, 1 hit
3.10.20.30, 1 hit
HAMAPiMF_00944, YchF_OLA1_ATPase, 1 hit
InterProiView protein in InterPro
IPR004396, ATPase_YchF/OLA1
IPR012675, Beta-grasp_dom_sf
IPR031167, G_OBG
IPR006073, GTP_binding_domain
IPR027417, P-loop_NTPase
IPR012676, TGS-like
IPR023192, TGS-like_dom_sf
IPR013029, YchF_C
IPR041706, YchF_N
PfamiView protein in Pfam
PF01926, MMR_HSR1, 1 hit
PF06071, YchF-GTPase_C, 1 hit
PIRSFiPIRSF006641, CHP00092, 1 hit
PRINTSiPR00326, GTP1OBG
SUPFAMiSSF52540, SSF52540, 1 hit
SSF81271, SSF81271, 1 hit
TIGRFAMsiTIGR00092, TIGR00092, 1 hit
PROSITEiView protein in PROSITE
PS51710, G_OBG, 1 hit
PS51880, TGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOLA1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NTK5
Secondary accession number(s): D7EHM2
, Q5BJD7, Q8NCI8, Q96CU1, Q96SV2, Q9P1D3, Q9UNY9, Q9Y6G4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: August 12, 2020
This is version 188 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again