Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAP3K12-binding inhibitory protein 1

Gene

MBIP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.1 Publication

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • molybdopterin synthase activity Source: GO_Central
  • protein kinase inhibitor activity Source: ProtInc

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
SignaLinkiQ9NS73

Names & Taxonomyi

Protein namesi
Recommended name:
MAP3K12-binding inhibitory protein 1
Alternative name(s):
MAPK upstream kinase-binding inhibitory protein
Short name:
MUK-binding inhibitory protein
Gene namesi
Name:MBIP
ORF Names:BM-015
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000151332.18
HGNCiHGNC:20427 MBIP
MIMi609431 gene
neXtProtiNX_Q9NS73

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000151332
PharmGKBiPA134929415

Polymorphism and mutation databases

BioMutaiMBIP
DMDMi160112798

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000962691 – 344MAP3K12-binding inhibitory protein 1Add BLAST344

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei91PhosphoserineCombined sources1
Cross-linki94Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki129Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki139Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki153Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki235Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei301N6-acetyllysine; alternateBy similarity1
Cross-linki301Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki304Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki325Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9NS73
MaxQBiQ9NS73
PaxDbiQ9NS73
PeptideAtlasiQ9NS73
PRIDEiQ9NS73
ProteomicsDBi82502
82503 [Q9NS73-2]
82504 [Q9NS73-3]
82505 [Q9NS73-5]

PTM databases

iPTMnetiQ9NS73
PhosphoSitePlusiQ9NS73

Expressioni

Tissue specificityi

Ubiquitous. High expression seen in the heart and lung.

Gene expression databases

BgeeiENSG00000151332 Expressed in 216 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_MBIP
ExpressionAtlasiQ9NS73 baseline and differential
GenevisibleiQ9NS73 HS

Organism-specific databases

HPAiHPA003388

Interactioni

Subunit structurei

Component of the ADA2A-containing complex (ATAC), composed of KAT14, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. In the complex, it probably interacts directly with KAT2A, KAT14 and WDR5.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119612, 91 interactors
ComplexPortaliCPX-1004 PCAF-containing ATAC complex
CPX-997 GCN5-containing ATAC complex
CORUMiQ9NS73
IntActiQ9NS73, 48 interactors
MINTiQ9NS73
STRINGi9606.ENSP00000399718

Structurei

3D structure databases

ProteinModelPortaliQ9NS73
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni172 – 344Interaction with MAP3K12Add BLAST173
Regioni271 – 285Leucine-zipper 1Sequence analysisAdd BLAST15
Regioni314 – 329Leucine-zipper 2Sequence analysisAdd BLAST16

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IFXK Eukaryota
ENOG410Y0HB LUCA
GeneTreeiENSGT00510000047831
HOGENOMiHOG000113491
HOVERGENiHBG052420
InParanoidiQ9NS73
OMAiEYFQSVN
OrthoDBiEOG091G0CV5
PhylomeDBiQ9NS73
TreeFamiTF331763

Family and domain databases

InterProiView protein in InterPro
IPR026062 MBIP
PANTHERiPTHR23404:SF3 PTHR23404:SF3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NS73-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAATELNRP SSGDRNLERR CRPNLSREVL YEIFRSLHTL VGQLDLRDDV
60 70 80 90 100
VKITIDWNKL QSLSAFQPAL LFSALEQHIL YLQPFLAKLQ SPIKEENTTA
110 120 130 140 150
VEEIGRTEMG NKNEVNDKFS IGDLQEEEKH KESDLRDVKK TQIHFDPEVV
160 170 180 190 200
QIKAGKAEID RRISAFIERK QAEINENNVR EFCNVIDCNQ ENSCARTDAI
210 220 230 240 250
FTPYPGFKSH VKVSRVVNTY GPQTRPEGIP GSGHKPNSML RDCGNQAVEE
260 270 280 290 300
RLQNIEAHLR LQTGGPVPRD IYQRIKKLED KILELEGISP EYFQSVSFSG
310 320 330 340
KRRKVQPPQQ NYSLAELDEK ISALKQALLR KSREAESMAT HHLP
Length:344
Mass (Da):39,281
Last modified:November 13, 2007 - v2
Checksum:i9DABB35CA8695C02
GO
Isoform 2 (identifier: Q9NS73-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-344: FSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP → L

Note: No experimental confirmation available.
Show »
Length:298
Mass (Da):34,023
Checksum:i00856BC8902FA9B3
GO
Isoform 3 (identifier: Q9NS73-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-344: GGPVPRDIYQ...AESMATHHLP → ELFWKKKKSSTTSTELFTG

Show »
Length:282
Mass (Da):32,223
Checksum:i4BD1C926F718E3B7
GO
Isoform 4 (identifier: Q9NS73-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: Missing.

Show »
Length:343
Mass (Da):39,153
Checksum:i97D44D5E8AB7DE60
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R2X9S4R2X9_HUMAN
MAP3K12-binding inhibitory protein ...
MBIP
299Annotation score:
A0A087X1L0A0A087X1L0_HUMAN
MAP3K12-binding inhibitory protein ...
MBIP
298Annotation score:
S4R3N2S4R3N2_HUMAN
MAP3K12-binding inhibitory protein ...
MBIP
281Annotation score:
S4R3P6S4R3P6_HUMAN
MAP3K12-binding inhibitory protein ...
MBIP
222Annotation score:
S4R3Y0S4R3Y0_HUMAN
MAP3K12-binding inhibitory protein ...
MBIP
112Annotation score:

Sequence cautioni

The sequence CAD62615 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti218N → Y in AAH05197 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0184497L → H3 PublicationsCorresponds to variant dbSNP:rs2899849Ensembl.1
Natural variantiVAR_03409322R → S3 PublicationsCorresponds to variant dbSNP:rs3168891Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010265264 – 344GGPVP…THHLP → ELFWKKKKSSTTSTELFTG in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_010266298 – 344FSGKR…THHLP → L in isoform 2. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_040134309Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB038523 mRNA Translation: BAA94083.1
AF208857 mRNA Translation: AAF64271.1
BX248287 mRNA Translation: CAD62615.1 Different initiation.
AL137226 Genomic DNA No translation available.
BC005197 mRNA Translation: AAH05197.1
BC016821 mRNA Translation: AAH16821.1
CCDSiCCDS45096.1 [Q9NS73-5]
CCDS76672.1 [Q9NS73-3]
CCDS9658.1 [Q9NS73-1]
RefSeqiNP_001138363.1, NM_001144891.1 [Q9NS73-5]
NP_001295039.1, NM_001308110.1 [Q9NS73-3]
NP_057670.2, NM_016586.2 [Q9NS73-1]
UniGeneiHs.368647

Genome annotation databases

EnsembliENST00000318473; ENSP00000324444; ENSG00000151332 [Q9NS73-5]
ENST00000359527; ENSP00000352517; ENSG00000151332 [Q9NS73-3]
ENST00000416007; ENSP00000399718; ENSG00000151332 [Q9NS73-1]
GeneIDi51562
KEGGihsa:51562
UCSCiuc001wtm.2 human [Q9NS73-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB038523 mRNA Translation: BAA94083.1
AF208857 mRNA Translation: AAF64271.1
BX248287 mRNA Translation: CAD62615.1 Different initiation.
AL137226 Genomic DNA No translation available.
BC005197 mRNA Translation: AAH05197.1
BC016821 mRNA Translation: AAH16821.1
CCDSiCCDS45096.1 [Q9NS73-5]
CCDS76672.1 [Q9NS73-3]
CCDS9658.1 [Q9NS73-1]
RefSeqiNP_001138363.1, NM_001144891.1 [Q9NS73-5]
NP_001295039.1, NM_001308110.1 [Q9NS73-3]
NP_057670.2, NM_016586.2 [Q9NS73-1]
UniGeneiHs.368647

3D structure databases

ProteinModelPortaliQ9NS73
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119612, 91 interactors
ComplexPortaliCPX-1004 PCAF-containing ATAC complex
CPX-997 GCN5-containing ATAC complex
CORUMiQ9NS73
IntActiQ9NS73, 48 interactors
MINTiQ9NS73
STRINGi9606.ENSP00000399718

PTM databases

iPTMnetiQ9NS73
PhosphoSitePlusiQ9NS73

Polymorphism and mutation databases

BioMutaiMBIP
DMDMi160112798

Proteomic databases

EPDiQ9NS73
MaxQBiQ9NS73
PaxDbiQ9NS73
PeptideAtlasiQ9NS73
PRIDEiQ9NS73
ProteomicsDBi82502
82503 [Q9NS73-2]
82504 [Q9NS73-3]
82505 [Q9NS73-5]

Protocols and materials databases

DNASUi51562
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318473; ENSP00000324444; ENSG00000151332 [Q9NS73-5]
ENST00000359527; ENSP00000352517; ENSG00000151332 [Q9NS73-3]
ENST00000416007; ENSP00000399718; ENSG00000151332 [Q9NS73-1]
GeneIDi51562
KEGGihsa:51562
UCSCiuc001wtm.2 human [Q9NS73-1]

Organism-specific databases

CTDi51562
EuPathDBiHostDB:ENSG00000151332.18
GeneCardsiMBIP
H-InvDBiHIX0011602
HGNCiHGNC:20427 MBIP
HPAiHPA003388
MIMi609431 gene
neXtProtiNX_Q9NS73
OpenTargetsiENSG00000151332
PharmGKBiPA134929415
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFXK Eukaryota
ENOG410Y0HB LUCA
GeneTreeiENSGT00510000047831
HOGENOMiHOG000113491
HOVERGENiHBG052420
InParanoidiQ9NS73
OMAiEYFQSVN
OrthoDBiEOG091G0CV5
PhylomeDBiQ9NS73
TreeFamiTF331763

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
SignaLinkiQ9NS73

Miscellaneous databases

GenomeRNAii51562
PROiPR:Q9NS73
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151332 Expressed in 216 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_MBIP
ExpressionAtlasiQ9NS73 baseline and differential
GenevisibleiQ9NS73 HS

Family and domain databases

InterProiView protein in InterPro
IPR026062 MBIP
PANTHERiPTHR23404:SF3 PTHR23404:SF3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMBIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NS73
Secondary accession number(s): Q86TZ2
, Q96AS5, Q9BS93, Q9NZE1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: November 13, 2007
Last modified: November 7, 2018
This is version 147 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again