Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

14 kDa phosphohistidine phosphatase

Gene

PHPT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Exhibits phosphohistidine phosphatase activity.2 Publications

Catalytic activityi

A [protein]-N-phospho-L-histidine + H2O = a [protein]-L-histidine + phosphate.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei21Substrate1 Publication1
Active sitei53Proton acceptor1 Publication1

GO - Molecular functioni

  • calcium channel inhibitor activity Source: BHF-UCL
  • ion channel binding Source: BHF-UCL
  • protein histidine phosphatase activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000054148-MONOMER

Names & Taxonomyi

Protein namesi
Recommended name:
14 kDa phosphohistidine phosphatase1 Publication (EC:3.9.1.32 Publications)
Alternative name(s):
Phosphohistidine phosphatase 11 Publication
Short name:
PHPT11 Publication
Protein histidine phosphatase1 Publication
Short name:
PHP1 Publication
Protein janus-A homolog
Gene namesi
Name:PHPT1
Synonyms:PHP14
ORF Names:CGI-202, HSPC141
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000054148.17
HGNCiHGNC:30033 PHPT1
MIMi610167 gene
neXtProtiNX_Q9NRX4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi21K → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1 Publication1
Mutagenesisi45R → A: Slightly decreased affinity for substrate, but no effect on catalytic activity. 2 Publications1
Mutagenesisi53H → A: Loss of activity. 2 Publications1
Mutagenesisi78R → A: Decreased affinity for substrate and reduced catalytic activity. 2 Publications1
Mutagenesisi94S → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1
Mutagenesisi102H → A: Decreased affinity for substrate and slightly reduced catalytic activity. 2 Publications1

Organism-specific databases

DisGeNETi29085
OpenTargetsiENSG00000054148
PharmGKBiPA134948141

Polymorphism and mutation databases

DMDMi25008934

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002061522 – 12514 kDa phosphohistidine phosphataseAdd BLAST124

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NRX4
PaxDbiQ9NRX4
PeptideAtlasiQ9NRX4
PRIDEiQ9NRX4
ProteomicsDBi82435
82436 [Q9NRX4-2]
TopDownProteomicsiQ9NRX4-1 [Q9NRX4-1]

PTM databases

DEPODiQ9NRX4
iPTMnetiQ9NRX4
PhosphoSitePlusiQ9NRX4

Expressioni

Tissue specificityi

Expressed abundantly in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000054148 Expressed in 181 organ(s), highest expression level in apex of heart
CleanExiHS_PHPT1
ExpressionAtlasiQ9NRX4 baseline and differential
GenevisibleiQ9NRX4 HS

Organism-specific databases

HPAiCAB013584
HPA020952

Interactioni

Subunit structurei

Monomer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
KCNN4O155542EBI-740955,EBI-2924473

GO - Molecular functioni

Protein-protein interaction databases

BioGridi118854, 20 interactors
DIPiDIP-48597N
IntActiQ9NRX4, 6 interactors
STRINGi9606.ENSP00000247665

Structurei

Secondary structure

1125
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NRX4
SMRiQ9NRX4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NRX4

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni94 – 96Substrate binding1 Publication3

Sequence similaritiesi

Belongs to the janus family.Curated

Phylogenomic databases

eggNOGiENOG410IZ5G Eukaryota
ENOG4111SA6 LUCA
GeneTreeiENSGT00390000002738
HOGENOMiHOG000231559
HOVERGENiHBG053589
InParanoidiQ9NRX4
KOiK01112
OMAiGWAEYHA
OrthoDBiEOG091G10Y7
PhylomeDBiQ9NRX4
TreeFamiTF315158

Family and domain databases

Gene3Di3.50.20.20, 1 hit
InterProiView protein in InterPro
IPR007702 Janus
IPR038596 Janus_sf
IPR028441 PHPT1
PANTHERiPTHR12258 PTHR12258, 1 hit
PTHR12258:SF10 PTHR12258:SF10, 1 hit
PfamiView protein in Pfam
PF05005 Ocnus, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NRX4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVADLALIP DVDIDSDGVF KYVLIRVHSA PRSGAPAAES KEIVRGYKWA
60 70 80 90 100
EYHADIYDKV SGDMQKQGCD CECLGGGRIS HQSQDKKIHV YGYSMAYGPA
110 120
QHAISTEKIK AKYPDYEVTW ANDGY
Length:125
Mass (Da):13,833
Last modified:October 1, 2000 - v1
Checksum:i24F0CA2BADB78478
GO
Isoform 2 (identifier: Q9NRX4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-125: AYGPAQHAISTEKIKAKYPDYEVTWANDGY → MRPTCVPLGASGPRIHHQGLWSCPARHFN

Show »
Length:124
Mass (Da):13,672
Checksum:iB504A355D275D9C6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14I → T in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti27V → I in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti79I → T in CAB66579 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04115996 – 125AYGPA…ANDGY → MRPTCVPLGASGPRIHHQGL WSCPARHFN in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF393504 mRNA Translation: AAN52504.1
AF164795 mRNA Translation: AAF80759.1
AF285119 mRNA Translation: AAG01156.1
AL136644 mRNA Translation: CAB66579.1
AL355987 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88289.1
BC024648 mRNA Translation: AAH24648.1
BQ922335 mRNA No translation available.
CCDSiCCDS48060.1 [Q9NRX4-2]
CCDS7009.1 [Q9NRX4-1]
RefSeqiNP_001129333.1, NM_001135861.2 [Q9NRX4-2]
NP_054891.2, NM_014172.5 [Q9NRX4-1]
UniGeneiHs.409834
Hs.731711

Genome annotation databases

EnsembliENST00000247665; ENSP00000247665; ENSG00000054148 [Q9NRX4-1]
ENST00000371661; ENSP00000360724; ENSG00000054148 [Q9NRX4-2]
GeneIDi29085
KEGGihsa:29085
UCSCiuc064xew.1 human [Q9NRX4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF393504 mRNA Translation: AAN52504.1
AF164795 mRNA Translation: AAF80759.1
AF285119 mRNA Translation: AAG01156.1
AL136644 mRNA Translation: CAB66579.1
AL355987 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88289.1
BC024648 mRNA Translation: AAH24648.1
BQ922335 mRNA No translation available.
CCDSiCCDS48060.1 [Q9NRX4-2]
CCDS7009.1 [Q9NRX4-1]
RefSeqiNP_001129333.1, NM_001135861.2 [Q9NRX4-2]
NP_054891.2, NM_014172.5 [Q9NRX4-1]
UniGeneiHs.409834
Hs.731711

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AI6NMR-A1-125[»]
2HW4X-ray1.90A5-125[»]
2NMMX-ray2.70A/B/C1-125[»]
2OZWNMR-A1-125[»]
2OZXNMR-A1-125[»]
ProteinModelPortaliQ9NRX4
SMRiQ9NRX4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118854, 20 interactors
DIPiDIP-48597N
IntActiQ9NRX4, 6 interactors
STRINGi9606.ENSP00000247665

PTM databases

DEPODiQ9NRX4
iPTMnetiQ9NRX4
PhosphoSitePlusiQ9NRX4

Polymorphism and mutation databases

DMDMi25008934

Proteomic databases

EPDiQ9NRX4
PaxDbiQ9NRX4
PeptideAtlasiQ9NRX4
PRIDEiQ9NRX4
ProteomicsDBi82435
82436 [Q9NRX4-2]
TopDownProteomicsiQ9NRX4-1 [Q9NRX4-1]

Protocols and materials databases

DNASUi29085
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000247665; ENSP00000247665; ENSG00000054148 [Q9NRX4-1]
ENST00000371661; ENSP00000360724; ENSG00000054148 [Q9NRX4-2]
GeneIDi29085
KEGGihsa:29085
UCSCiuc064xew.1 human [Q9NRX4-1]

Organism-specific databases

CTDi29085
DisGeNETi29085
EuPathDBiHostDB:ENSG00000054148.17
GeneCardsiPHPT1
HGNCiHGNC:30033 PHPT1
HPAiCAB013584
HPA020952
MIMi610167 gene
neXtProtiNX_Q9NRX4
OpenTargetsiENSG00000054148
PharmGKBiPA134948141
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZ5G Eukaryota
ENOG4111SA6 LUCA
GeneTreeiENSGT00390000002738
HOGENOMiHOG000231559
HOVERGENiHBG053589
InParanoidiQ9NRX4
KOiK01112
OMAiGWAEYHA
OrthoDBiEOG091G10Y7
PhylomeDBiQ9NRX4
TreeFamiTF315158

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000054148-MONOMER

Miscellaneous databases

ChiTaRSiPHPT1 human
EvolutionaryTraceiQ9NRX4
GeneWikiiPHPT1
GenomeRNAii29085
PROiPR:Q9NRX4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000054148 Expressed in 181 organ(s), highest expression level in apex of heart
CleanExiHS_PHPT1
ExpressionAtlasiQ9NRX4 baseline and differential
GenevisibleiQ9NRX4 HS

Family and domain databases

Gene3Di3.50.20.20, 1 hit
InterProiView protein in InterPro
IPR007702 Janus
IPR038596 Janus_sf
IPR028441 PHPT1
PANTHERiPTHR12258 PTHR12258, 1 hit
PTHR12258:SF10 PTHR12258:SF10, 1 hit
PfamiView protein in Pfam
PF05005 Ocnus, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPHP14_HUMAN
AccessioniPrimary (citable) accession number: Q9NRX4
Secondary accession number(s): B1AMX0, B1AMX1, Q9H0Y3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: September 12, 2018
This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again