Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We are aiming to switch to the new UniProt website on Monday, May 9. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9NRX4 (PHP14_HUMAN)

Entry version 173 (23 Feb 2022)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

14 kDa phosphohistidine phosphatase

Gene

PHPT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exhibits phosphohistidine phosphatase activity.

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei21Substrate1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei53Proton acceptor1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.9.1.3, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NRX4

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9NRX4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
14 kDa phosphohistidine phosphatase1 Publication (EC:3.9.1.32 Publications)
Alternative name(s):
Phosphohistidine phosphatase 11 Publication
Short name:
PHPT11 Publication
Protein histidine phosphatase1 Publication
Short name:
PHP1 Publication
Protein janus-A homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PHPT1
Synonyms:PHP14
ORF Names:CGI-202, HSPC141
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30033, PHPT1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610167, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NRX4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000054148

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi21K → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1 Publication1
Mutagenesisi45R → A: Slightly decreased affinity for substrate, but no effect on catalytic activity. 2 Publications1
Mutagenesisi53H → A: Loss of activity. 2 Publications1
Mutagenesisi78R → A: Decreased affinity for substrate and reduced catalytic activity. 2 Publications1
Mutagenesisi94S → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1
Mutagenesisi102H → A: Decreased affinity for substrate and slightly reduced catalytic activity. 2 Publications1

Organism-specific databases

DisGeNET

More...DisGeNETi		29085

Open Targets

More...OpenTargetsi		ENSG00000054148

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134948141

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NRX4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PHPT1

Domain mapping of disease mutations (DMDM)

More...DMDMi		25008934

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002061522 – 12514 kDa phosphohistidine phosphataseAdd BLAST124

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NRX4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NRX4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NRX4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NRX4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NRX4

PeptideAtlas

More...PeptideAtlasi		Q9NRX4

PRoteomics IDEntifications database

More...PRIDEi		Q9NRX4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		82435 [Q9NRX4-1]
82436 [Q9NRX4-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9NRX4-1 [Q9NRX4-1]

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		PHPT1

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NRX4

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9NRX4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NRX4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed abundantly in heart and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000054148, Expressed in apex of heart and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NRX4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NRX4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000054148, Tissue enhanced (tongue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		118854, 40 interactors

Database of interacting proteins

More...DIPi		DIP-48597N

Protein interaction database and analysis system

More...IntActi		Q9NRX4, 8 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000247665

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NRX4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1125
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9NRX4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NRX4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NRX4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni94 – 96Substrate binding1 Publication3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the janus family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S4DR, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000002738

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_120717_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NRX4

Identification of Orthologs from Complete Genome Data

More...OMAi		VRYPDYE

Database of Orthologous Groups

More...OrthoDBi		1529401at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NRX4

TreeFam database of animal gene trees

More...TreeFami		TF315158

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.50.20.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007702, Janus
IPR038596, Janus_sf
IPR028441, PHPT1

The PANTHER Classification System

More...PANTHERi		PTHR12258, PTHR12258, 1 hit
PTHR12258:SF10, PTHR12258:SF10, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05005, Ocnus, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NRX4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVADLALIP DVDIDSDGVF KYVLIRVHSA PRSGAPAAES KEIVRGYKWA 
        60         70         80         90        100
EYHADIYDKV SGDMQKQGCD CECLGGGRIS HQSQDKKIHV YGYSMAYGPA 
       110        120 
QHAISTEKIK AKYPDYEVTW ANDGY
Length:125
Mass (Da):13,833
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i24F0CA2BADB78478
GO
Isoform 2 (identifier: Q9NRX4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-125: AYGPAQHAISTEKIKAKYPDYEVTWANDGY → MRPTCVPLGASGPRIHHQGLWSCPARHFN

Show »
Length:124
Mass (Da):13,672
Checksum:iB504A355D275D9C6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14I → T in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti27V → I in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti79I → T in CAB66579 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04115996 – 125AYGPA…ANDGY → MRPTCVPLGASGPRIHHQGL WSCPARHFN in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF393504 mRNA Translation: AAN52504.1
AF164795 mRNA Translation: AAF80759.1
AF285119 mRNA Translation: AAG01156.1
AL136644 mRNA Translation: CAB66579.1
AL355987 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88289.1
BC024648 mRNA Translation: AAH24648.1
BQ922335 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS48060.1 [Q9NRX4-2]
CCDS7009.1 [Q9NRX4-1]

NCBI Reference Sequences

More...RefSeqi		NP_001129333.1, NM_001135861.2 [Q9NRX4-2]
NP_054891.2, NM_014172.5 [Q9NRX4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000247665; ENSP00000247665; ENSG00000054148
ENST00000371661; ENSP00000360724; ENSG00000054148 [Q9NRX4-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29085

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:29085

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000247665.12; ENSP00000247665.10; NM_014172.6; NP_054891.2

UCSC genome browser

More...UCSCi		uc064xew.1, human [Q9NRX4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF393504 mRNA Translation: AAN52504.1
AF164795 mRNA Translation: AAF80759.1
AF285119 mRNA Translation: AAG01156.1
AL136644 mRNA Translation: CAB66579.1
AL355987 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88289.1
BC024648 mRNA Translation: AAH24648.1
BQ922335 mRNA No translation available.
CCDSiCCDS48060.1 [Q9NRX4-2]
CCDS7009.1 [Q9NRX4-1]
RefSeqiNP_001129333.1, NM_001135861.2 [Q9NRX4-2]
NP_054891.2, NM_014172.5 [Q9NRX4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AI6NMR-A1-125[»]
2HW4X-ray1.90A5-125[»]
2NMMX-ray2.70A/B/C1-125[»]
2OZWNMR-A1-125[»]
2OZXNMR-A1-125[»]
BMRBiQ9NRX4
SMRiQ9NRX4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi118854, 40 interactors
DIPiDIP-48597N
IntActiQ9NRX4, 8 interactors
STRINGi9606.ENSP00000247665

PTM databases

DEPODiPHPT1
iPTMnetiQ9NRX4
MetOSiteiQ9NRX4
PhosphoSitePlusiQ9NRX4

Genetic variation databases

BioMutaiPHPT1
DMDMi25008934

Proteomic databases

EPDiQ9NRX4
jPOSTiQ9NRX4
MassIVEiQ9NRX4
MaxQBiQ9NRX4
PaxDbiQ9NRX4
PeptideAtlasiQ9NRX4
PRIDEiQ9NRX4
ProteomicsDBi82435 [Q9NRX4-1]
82436 [Q9NRX4-2]
TopDownProteomicsiQ9NRX4-1 [Q9NRX4-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		18807, 382 antibodies from 31 providers

The DNASU plasmid repository

More...DNASUi		29085

Genome annotation databases

EnsembliENST00000247665; ENSP00000247665; ENSG00000054148
ENST00000371661; ENSP00000360724; ENSG00000054148 [Q9NRX4-2]
GeneIDi29085
KEGGihsa:29085
MANE-SelectiENST00000247665.12; ENSP00000247665.10; NM_014172.6; NP_054891.2
UCSCiuc064xew.1, human [Q9NRX4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		29085
DisGeNETi29085

GeneCards: human genes, protein and diseases

More...GeneCardsi		PHPT1
HGNCiHGNC:30033, PHPT1
HPAiENSG00000054148, Tissue enhanced (tongue)
MIMi610167, gene
neXtProtiNX_Q9NRX4
OpenTargetsiENSG00000054148
PharmGKBiPA134948141
VEuPathDBiHostDB:ENSG00000054148

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S4DR, Eukaryota
GeneTreeiENSGT00390000002738
HOGENOMiCLU_120717_0_1_1
InParanoidiQ9NRX4
OMAiVRYPDYE
OrthoDBi1529401at2759
PhylomeDBiQ9NRX4
TreeFamiTF315158

Enzyme and pathway databases

BRENDAi3.9.1.3, 2681
PathwayCommonsiQ9NRX4
SignaLinkiQ9NRX4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		29085, 18 hits in 1046 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PHPT1, human
EvolutionaryTraceiQ9NRX4

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PHPT1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		29085
PharosiQ9NRX4, Tbio

Protein Ontology

More...PROi		PR:Q9NRX4
RNActiQ9NRX4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000054148, Expressed in apex of heart and 196 other tissues
ExpressionAtlasiQ9NRX4, baseline and differential
GenevisibleiQ9NRX4, HS

Family and domain databases

Gene3Di3.50.20.20, 1 hit
InterProiView protein in InterPro
IPR007702, Janus
IPR038596, Janus_sf
IPR028441, PHPT1
PANTHERiPTHR12258, PTHR12258, 1 hit
PTHR12258:SF10, PTHR12258:SF10, 1 hit
PfamiView protein in Pfam
PF05005, Ocnus, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHP14_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NRX4
Secondary accession number(s): B1AMX0, B1AMX1, Q9H0Y3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: February 23, 2022
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again