Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9NRW4 (DUS22_HUMAN)

Entry version 173 (23 Feb 2022)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Dual specificity protein phosphatase 22

Gene

DUSP22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Activates the Jnk signaling pathway.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei88Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NRW4

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		Q9NRW4

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9NRW4

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9NRW4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity protein phosphatase 22 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
JNK-stimulatory phosphatase-1
Short name:
JSP-1
Low molecular weight dual specificity phosphatase 2
Short name:
LMW-DSP2
Mitogen-activated protein kinase phosphatase x
Short name:
MAP kinase phosphatase x
Short name:
MKP-x
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DUSP22
Synonyms:JSP1, LMWDSP2, MKPX
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16077, DUSP22

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NRW4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000112679

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		56940

Open Targets

More...OpenTargetsi		ENSG00000112679

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134991025

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NRW4, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3924

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		DUSP22

Domain mapping of disease mutations (DMDM)

More...DMDMi		74752929

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002447512 – 184Dual specificity protein phosphatase 22Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei58PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Myristoylation regulates subcellular location, and is necessary for activation of JNK.1 Publication

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NRW4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NRW4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NRW4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NRW4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NRW4

PeptideAtlas

More...PeptideAtlasi		Q9NRW4

PRoteomics IDEntifications database

More...PRIDEi		Q9NRW4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		82429 [Q9NRW4-1]
82430 [Q9NRW4-2]

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		DUSP22

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NRW4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NRW4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000112679, Expressed in epithelium of mammary gland and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NRW4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NRW4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000112679, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		121264, 138 interactors

Protein interaction database and analysis system

More...IntActi		Q9NRW4, 44 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000397459

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9NRW4

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NRW4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NRW4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NRW4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 144Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST141

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1716, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157153

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_027074_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NRW4

Identification of Orthologs from Complete Genome Data

More...OMAi		CAYLMWK

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NRW4

TreeFam database of animal gene trees

More...TreeFami		TF105126

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000340, Dual-sp_phosphatase_cat-dom
IPR029021, Prot-tyrosine_phosphatase-like
IPR000387, Tyr_Pase_dom
IPR020422, TYR_PHOSPHATASE_DUAL_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00782, DSPc, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00195, DSPc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52799, SSF52799, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50054, TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NRW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNGMNKILP GLYIGNFKDA RDAEQLSKNK VTHILSVHDS ARPMLEGVKY 
        60         70         80         90        100
LCIPAADSPS QNLTRHFKES IKFIHECRLR GESCLVHCLA GVSRSVTLVI 
       110        120        130        140        150
AYIMTVTDFG WEDALHTVRA GRSCANPNVG FQRQLQEFEK HEVHQYRQWL 
       160        170        180 
KEEYGESPLQ DAEEAKNILA APGILKFWAF LRRL
Length:184
Mass (Da):20,910
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB3F962A087C2BA20
GO
Isoform 2 (identifier: Q9NRW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-184: AAPGILKFWAFLRRL → GKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET

Show »
Length:205
Mass (Da):23,268
Checksum:i48334A97991FCFF8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3A4S4R3A4_HUMAN
Dual-specificity protein phosphatas...
DUSP22
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R378S4R378_HUMAN
Dual-specificity protein phosphatas...
DUSP22
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3M1S4R3M1_HUMAN
Dual-specificity protein phosphatas...
DUSP22
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R459S4R459_HUMAN
Dual-specificity protein phosphatas...
DUSP22
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3K1S4R3K1_HUMAN
Dual-specificity protein phosphatas...
DUSP22
18Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH16844 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026912119R → H. Corresponds to variant dbSNP:rs7768224Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019614170 – 184AAPGI…FLRRL → GKYKEQGRTEPQPGARRWSS FPALAPLTYDNYTTET in isoform 2. 2 PublicationsAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF424702 mRNA Translation: AAL18850.1
AF165519 mRNA Translation: AAF86649.1
AY249859 mRNA Translation: AAP76376.1
AK296402 mRNA Translation: BAG59068.1
AL365272 Genomic DNA No translation available.
BC016844 mRNA Translation: AAH16844.1 Different initiation.
BC022847 mRNA Translation: AAH22847.1
AB208997 mRNA Translation: BAD92234.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4468.1 [Q9NRW4-1]
CCDS69035.1 [Q9NRW4-2]

NCBI Reference Sequences

More...RefSeqi		NP_001273484.1, NM_001286555.1 [Q9NRW4-2]
NP_064570.1, NM_020185.4 [Q9NRW4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000344450; ENSP00000345281; ENSG00000112679
ENST00000419235; ENSP00000397459; ENSG00000112679 [Q9NRW4-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		56940

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:56940

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000419235.7; ENSP00000397459.2; NM_001286555.3; NP_001273484.1 [Q9NRW4-2]

UCSC genome browser

More...UCSCi		uc003msx.5, human [Q9NRW4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF424702 mRNA Translation: AAL18850.1
AF165519 mRNA Translation: AAF86649.1
AY249859 mRNA Translation: AAP76376.1
AK296402 mRNA Translation: BAG59068.1
AL365272 Genomic DNA No translation available.
BC016844 mRNA Translation: AAH16844.1 Different initiation.
BC022847 mRNA Translation: AAH22847.1
AB208997 mRNA Translation: BAD92234.1
CCDSiCCDS4468.1 [Q9NRW4-1]
CCDS69035.1 [Q9NRW4-2]
RefSeqiNP_001273484.1, NM_001286555.1 [Q9NRW4-2]
NP_064570.1, NM_020185.4 [Q9NRW4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WRMX-ray1.50A1-163[»]
4WOHX-ray1.34A1-163[»]
6L1SX-ray1.36A1-155[»]
6LMYX-ray1.50A1-155[»]
6LOTX-ray1.69A1-155[»]
6LOUX-ray1.53A1-155[»]
6LVQX-ray1.38A1-155[»]
7C8SX-ray1.31A1-155[»]
SMRiQ9NRW4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi121264, 138 interactors
IntActiQ9NRW4, 44 interactors
STRINGi9606.ENSP00000397459

Chemistry databases

BindingDBiQ9NRW4
ChEMBLiCHEMBL3924

PTM databases

DEPODiDUSP22
iPTMnetiQ9NRW4
PhosphoSitePlusiQ9NRW4

Genetic variation databases

BioMutaiDUSP22
DMDMi74752929

Proteomic databases

EPDiQ9NRW4
jPOSTiQ9NRW4
MassIVEiQ9NRW4
MaxQBiQ9NRW4
PaxDbiQ9NRW4
PeptideAtlasiQ9NRW4
PRIDEiQ9NRW4
ProteomicsDBi82429 [Q9NRW4-1]
82430 [Q9NRW4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		9106, 315 antibodies from 32 providers

The DNASU plasmid repository

More...DNASUi		56940

Genome annotation databases

EnsembliENST00000344450; ENSP00000345281; ENSG00000112679
ENST00000419235; ENSP00000397459; ENSG00000112679 [Q9NRW4-2]
GeneIDi56940
KEGGihsa:56940
MANE-SelectiENST00000419235.7; ENSP00000397459.2; NM_001286555.3; NP_001273484.1 [Q9NRW4-2]
UCSCiuc003msx.5, human [Q9NRW4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		56940
DisGeNETi56940

GeneCards: human genes, protein and diseases

More...GeneCardsi		DUSP22
HGNCiHGNC:16077, DUSP22
HPAiENSG00000112679, Low tissue specificity
neXtProtiNX_Q9NRW4
OpenTargetsiENSG00000112679
PharmGKBiPA134991025
VEuPathDBiHostDB:ENSG00000112679

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1716, Eukaryota
GeneTreeiENSGT00940000157153
HOGENOMiCLU_027074_5_1_1
InParanoidiQ9NRW4
OMAiCAYLMWK
PhylomeDBiQ9NRW4
TreeFamiTF105126

Enzyme and pathway databases

PathwayCommonsiQ9NRW4
SABIO-RKiQ9NRW4
SignaLinkiQ9NRW4
SIGNORiQ9NRW4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		56940, 20 hits in 1053 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		DUSP22, human
EvolutionaryTraceiQ9NRW4

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		DUSP22

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		56940
PharosiQ9NRW4, Tbio

Protein Ontology

More...PROi		PR:Q9NRW4
RNActiQ9NRW4, protein

Gene expression databases

BgeeiENSG00000112679, Expressed in epithelium of mammary gland and 238 other tissues
ExpressionAtlasiQ9NRW4, baseline and differential
GenevisibleiQ9NRW4, HS

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR000340, Dual-sp_phosphatase_cat-dom
IPR029021, Prot-tyrosine_phosphatase-like
IPR000387, Tyr_Pase_dom
IPR020422, TYR_PHOSPHATASE_DUAL_dom
PfamiView protein in Pfam
PF00782, DSPc, 1 hit
SMARTiView protein in SMART
SM00195, DSPc, 1 hit
SUPFAMiSSF52799, SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50054, TYR_PHOSPHATASE_DUAL, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDUS22_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NRW4
Secondary accession number(s): B4DK56
, Q59GW2, Q5VWR2, Q96AR1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: October 1, 2000
Last modified: February 23, 2022
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again